SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228324 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228324
Domain Number 1 Region: 109-163
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000126
Family Tachycitin 0.044
Further Details:      
 
Domain Number 2 Region: 50-104
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000785
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228324   Gene: FBgn0201125   Transcript: FBtr0229832
Sequence length 166
Comment type=protein; loc=scaffold_13049:join(21080196..21080202,21080300..21080793); ID=FBpp0228324; name=Dvir\GJ13907-PA; parent=FBgn0201125,FBtr0229832; dbxref=FlyBase:FBpp0228324,FlyBase_Annotation_IDs:GJ13907-PA,GB_protein:EDW70669,REFSEQ:XP_002048327,FlyMine:FBpp0228324; MD5=497d3a93e690b2971def5665e089770f; length=166; release=r1.2; species=Dvir;
Sequence
MKVLCYAITAFALPIDESTTLEISTIETTTAETDTTETPTSATTEIDTTFEPPVLCDDGV
QFLPAPNCDQFYLCAYGIGILKTCPNGLYWDPSLDVCNWGSDYCESDPPVPESPESDCST
GNQFVPDESDCTKYIQCVYNIGIQMSCPPGLFWNQPLQRCDYECKF
Download sequence
Identical sequences 7244.FBpp0228324 FBpp0228324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]