SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228325 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228325
Domain Number 1 Region: 86-145
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000497
Family Tachycitin 0.032
Further Details:      
 
Domain Number 2 Region: 150-203
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000915
Family Tachycitin 0.036
Further Details:      
 
Domain Number 3 Region: 25-77
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000243
Family Tachycitin 0.025
Further Details:      
 
Domain Number 4 Region: 199-251
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000262
Family Tachycitin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228325   Gene: FBgn0201126   Transcript: FBtr0229833
Sequence length 257
Comment type=protein; loc=scaffold_13049:join(21081900..21081912,21081973..21082031,21082097..21082798); ID=FBpp0228325; name=Dvir\GJ13908-PA; parent=FBgn0201126,FBtr0229833; dbxref=FlyBase:FBpp0228325,FlyBase_Annotation_IDs:GJ13908-PA,GB_protein:EDW70670,REFSEQ:XP_002048328,FlyMine:FBpp0228325; MD5=be15d0c9f9e7e68f9d0b79cd57e2d8c9; length=257; release=r1.2; species=Dvir;
Sequence
MKAFTLALVGLLVVLGARAQSLKEQCKGIQYDLLPYPDKNDQFIVCAYEVPEVRSCMQGT
CFDPILKGCSDSACTPTTPSDKDIATTFCTELRGGEKIPSVDCSHFWICLTEMEPVYVAC
PQGKHYSRSEHECVSPALAKCATPEKLCESNYNTYAAETCNEYYGCTNKKLIKRSCPYGE
AYSAESAACIKDLSHSCVTDSKPDCQNPANANAYFSHSDCTKFYVCIQAQVFEGKCADGY
GFDRQSSNCRLGICKSN
Download sequence
Identical sequences B4LHU5
7244.FBpp0228325 FBpp0228325 XP_002048328.1.90633 XP_015031513.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]