SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228327 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228327
Domain Number 1 Region: 210-273
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.17e-17
Family Tachycitin 0.007
Further Details:      
 
Domain Number 2 Region: 29-88
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000523
Family Tachycitin 0.029
Further Details:      
 
Domain Number 3 Region: 133-192
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000732
Family Tachycitin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228327   Gene: FBgn0201128   Transcript: FBtr0229835
Sequence length 291
Comment type=protein; loc=scaffold_13049:join(21092328..21092393,21092452..21093261); ID=FBpp0228327; name=Dvir\GJ13910-PA; parent=FBgn0201128,FBtr0229835; dbxref=FlyBase:FBpp0228327,FlyBase_Annotation_IDs:GJ13910-PA,GB_protein:EDW70674,REFSEQ:XP_002048332,FlyMine:FBpp0228327; MD5=1a6c73533de3117505bbed2c14d3a470; length=291; release=r1.2; species=Dvir;
Sequence
MKSLVALWIILILNKTAVAQLKDGFMFHTSICKGKNGVLLPMFGKCRGYYICNEGKAVAG
SCDEDSRFNPLTLHCDDVDNVICPYETPDDDEDTEIDTSEADTLEFDSDEIEEPPVNTKP
PKQLPNPNKNHIANLCFHKKNGVALPKAGSCTEYYMCRSKLAHLRHCPGRQHFSPTRKLC
MKASEAKCSISQVQVQVSTTEEPKSSPAVTAGLCSDEKQDALVPHRNDCSKFLLCSNMMF
LVMDCPPGLHFNAKVRRCDYPKIAQCEVPKKPTKRNKKKLSKKSKPKGSLF
Download sequence
Identical sequences B4LHU9
FBpp0228327 XP_002048332.1.90633 7244.FBpp0228327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]