SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228328 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228328
Domain Number 1 Region: 154-219
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000994
Family Tachycitin 0.033
Further Details:      
 
Domain Number 2 Region: 92-157
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000471
Family Tachycitin 0.01
Further Details:      
 
Domain Number 3 Region: 222-286
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000759
Family Tachycitin 0.044
Further Details:      
 
Domain Number 4 Region: 284-334
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000068
Family Tachycitin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228328   Gene: FBgn0201129   Transcript: FBtr0229836
Sequence length 355
Comment type=protein; loc=scaffold_13049:21102842..21103909; ID=FBpp0228328; name=Dvir\GJ13911-PA; parent=FBgn0201129,FBtr0229836; dbxref=FlyBase:FBpp0228328,FlyBase_Annotation_IDs:GJ13911-PA,GB_protein:EDW70677,REFSEQ:XP_002048335,FlyMine:FBpp0228328; MD5=3715c43f2d71aa3c4742dca4f830f44e; length=355; release=r1.2; species=Dvir;
Sequence
MQGTVRAASVLLLLLALAVQLQHSSQTEYISSGKDICRLFPDGTKIRKPGYCDRTVVCQN
HVSTDDEICSGSTPYFNLAKGTCYKSLETSDNYCKSPCTSKTTGYVGDAYNCANWYYCEK
TKLVTSGVCGFDMWFDQERQVCDYPKFVTCNAKYELCNVVPAGITIRDELYCNKYLTCKA
GANTTIVCDDGLYYDAATATCIKKALVDCEKHPYPENVCGTKKLAIRDKFVADGATCRGY
FHCRDLGSGVPDPEPQWHQCPVETFFNEDIQLCQPRADRKCSEDRCDGRDSGFELAQIEG
CQNYFECENGVEKTPFKCDDNMYFDVATEACTAEKKEYGSCSSDKDKYDPNNWVL
Download sequence
Identical sequences 7244.FBpp0228328 FBpp0228328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]