SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228420 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228420
Domain Number 1 Region: 305-403
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.75e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 26-108
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 111-165,193-209
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000759
Family Flavin-binding PAS domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228420   Gene: FBgn0201221   Transcript: FBtr0229928
Sequence length 407
Comment type=protein; loc=scaffold_13049:join(22917731..22917816,22917879..22918327,22918385..22918811,22918869..22919130); ID=FBpp0228420; name=Dvir\GJ14003-PA; parent=FBgn0201221,FBtr0229928; dbxref=FlyBase:FBpp0228420,FlyBase_Annotation_IDs:GJ14003-PA,GB_protein:EDW70838,REFSEQ:XP_002048496,FlyMine:FBpp0228420; MD5=7678b9bcb38a3ea60d2e1bd505da3bf6; length=407; release=r1.2; species=Dvir;
Sequence
ISFYSENRNELEDEPFDEEKSMRTDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCYAM
QRKLDKLTVLRMAVQHLRGIRGGLHPYNGASYRPSFLSEQELKMIILQASEGFLFVVGCD
RGRILYVSESVTSVLNCTPGDLLGQSWFDVLHPKDISKVKEQLSSLEQCPRERLIDAKTM
LPVKTDVPQSLCRLCPGGRRSFFCRMKLRAANDQIKEESDTSSSSRSSSKRKSKLSMDHK
YQIIQCTGYLKSWMPIKDEEQDGDSDDQTTNLACLVAIGRIPTNVLKTSMPTTLVHNPNI
RHVLFISRHSAEGKFLFIDQRATLVIGYLPQEILGTSFYEYFHNEDITALVESHKMVMQL
HENVTTQIYRFRCKDNGYVQLQSEWRAFKNPWTNDIDYIIAKNSVFL
Download sequence
Identical sequences FBpp0228420 7244.FBpp0228420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]