SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228733 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228733
Domain Number 1 Region: 25-76
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000392
Family Tachycitin 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228733   Gene: FBgn0201530   Transcript: FBtr0230241
Sequence length 204
Comment type=protein; loc=scaffold_12822:complement(879703..880310,880374..880380); ID=FBpp0228733; name=Dvir\GJ14316-PA; parent=FBgn0201530,FBtr0230241; dbxref=FlyBase:FBpp0228733,FlyBase_Annotation_IDs:GJ14316-PA,GB_protein:EDW58397,REFSEQ:XP_002058429,FlyMine:FBpp0228733; MD5=389bd2d0bbe434a809be42d679b6eba3; length=204; release=r1.2; species=Dvir;
Sequence
MKVFALTLLGLLALAQARIDYKLQCTRDEVGIRWPSYYSNSEYYVCQSVYGSQLTVHCPA
GQVFTFVLQQCAAPALYVPAPPMDVLPTAAPITTHLVDEAPPVLASVGGVQPIHAHEPAQ
EQVVHALPLDPTPPTPPTEPPTPPTVAVEAPKPGKKPAAPQPPKTAAPKKPAAKKPAAPA
PPKAAKKPTPPSKAQKKPPTQSSA
Download sequence
Identical sequences FBpp0228733 7244.FBpp0228733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]