SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228734 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0228734
Domain Number - Region: 35-83
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000314
Family Tachycitin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228734   Gene: FBgn0201531   Transcript: FBtr0230242
Sequence length 207
Comment type=protein; loc=scaffold_12822:complement(877083..877696,877750..877759); ID=FBpp0228734; name=Dvir\GJ14317-PA; parent=FBgn0201531,FBtr0230242; dbxref=FlyBase:FBpp0228734,FlyBase_Annotation_IDs:GJ14317-PA,GB_protein:EDW58396,REFSEQ:XP_002058428,FlyMine:FBpp0228734; MD5=e205591a965df3a98d87fc7c455b0ff8; length=207; release=r1.2; species=Dvir;
Sequence
MRAVLIAVTGLLAISVRAQESCVTPEYTTDIVPVCQANLRIKLPSYADPTSYYSCTTGKP
ILTQCKAPTGYFSYVLQECTSCANYLPAVACEEIKLNLKCEPISESGVTTAAPPGNSTAA
PTTVTTAAPPGDSTSAAPTTVTTKDPTTAAPTTVTTGASTTVDGNEPSGTTISIPNPPSP
NDPNVPAPPTPAPTAGTIVPGPPTVGV
Download sequence
Identical sequences FBpp0228734 7244.FBpp0228734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]