SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228823 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228823
Domain Number 1 Region: 41-90
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000889
Family Antifungal peptide scarabaecin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228823   Gene: FBgn0201619   Transcript: FBtr0230331
Sequence length 94
Comment type=protein; loc=scaffold_12822:join(843198..843207,843273..843547); ID=FBpp0228823; name=Dvir\GJ14406-PA; parent=FBgn0201619,FBtr0230331; dbxref=FlyBase:FBpp0228823,FlyBase_Annotation_IDs:GJ14406-PA,GB_protein:EDW58393,REFSEQ:XP_002058425,FlyMine:FBpp0228823; MD5=b21873639add134f5e2ed42d5d451a8c; length=94; release=r1.2; species=Dvir;
Sequence
MHQATIFSFLLFGILVTLASAYNGQDIYAEPNCAIVDDHARKFRDISDPTHYWVCPEGQE
KADYIQCPDNYAFMEPQQDCVVWEEWKWLEPYTK
Download sequence
Identical sequences B4MBC2
7244.FBpp0228823 XP_002058425.1.90633 FBpp0228823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]