SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228912 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228912
Domain Number 1 Region: 86-149
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000706
Family Tachycitin 0.015
Further Details:      
 
Domain Number 2 Region: 21-88
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000915
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 156-220
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000628
Family Tachycitin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228912   Gene: FBgn0201706   Transcript: FBtr0230420
Sequence length 256
Comment type=protein; loc=scaffold_12822:join(1971171..1971213,1979098..1979307,1979374..1979562,1979626..1979836,1980199..1980316); ID=FBpp0228912; name=Dvir\GJ14495-PA; parent=FBgn0201706,FBtr0230420; dbxref=FlyBase:FBpp0228912,FlyBase_Annotation_IDs:GJ14495-PA,GB_protein:EDW58542,REFSEQ:XP_002058574,FlyMine:FBpp0228912; MD5=556c68d1797a9c1d1eeacdedb644ca42; length=256; release=r1.2; species=Dvir;
Sequence
MKKFIVVFVALFGAAVAQQSFKCPDDFGFYPHETSCDKYWKCDNGVSELKTCGNGLAFDA
TDSKFLTENCDYLHNVECGERTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRY
QCSPGLAYDRDARVCMWADQVPECKNEEVANGFACPAAGELANTGSFSRHAHPEDCRKYY
ICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSELLAGLN
TEGRTKSAPKTKAATS
Download sequence
Identical sequences B4MBS1
FBpp0228912 7244.FBpp0228912 XP_002058574.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]