SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228967 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228967
Domain Number 1 Region: 34-91
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000141
Family Tachycitin 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228967   Gene: FBgn0201757   Transcript: FBtr0230475
Sequence length 97
Comment type=protein; loc=scaffold_12822:3322236..3322529; ID=FBpp0228967; name=Dvir\GJ14550-PA; parent=FBgn0201757,FBtr0230475; dbxref=FlyBase:FBpp0228967,FlyBase_Annotation_IDs:GJ14550-PA,GB_protein:EDW58640,REFSEQ:XP_002058672,FlyMine:FBpp0228967; MD5=d03b937e428dd95337d126d9c3f1abde; length=97; release=r1.2; species=Dvir;
Sequence
MKLQLTICLVLVAACGLVNAYNGDGQPGCKTQEELDVGIYRDNWDATSYWKCETLNEPAI
KVRCPDETGFVDSLKDCVSWDDWTWEKPVAPPSEVDE
Download sequence
Identical sequences B4MC19
FBpp0228967 XP_002058672.1.90633 7244.FBpp0228967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]