SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0229133 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0229133
Domain Number 1 Region: 944-1194
Classification Level Classification E-value
Superfamily VPS9 domain 4.58e-45
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily SH2 domain 0.000000138
Family SH2 domain 0.0032
Further Details:      
 
Weak hits

Sequence:  FBpp0229133
Domain Number - Region: 1209-1276
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000248
Family Ras-binding domain, RBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0229133   Gene: FBgn0201923   Transcript: FBtr0230641
Sequence length 1307
Comment type=protein; loc=scaffold_12932:complement(1718336..1718668,1718744..1719570,1724985..1725245,1725319..1726320,1726844..1727175,1727224..1728392); ID=FBpp0229133; name=Dvir\GJ14716-PA; parent=FBgn0201923,FBtr0230641; dbxref=FlyBase:FBpp0229133,FlyBase_Annotation_IDs:GJ14716-PA,GB_protein:EDW63051,REFSEQ:XP_002059629,FlyMine:FBpp0229133; MD5=f204794f3f616bc213273e3ba8be33a3; length=1307; release=r1.2; species=Dvir;
Sequence
MAVSVRLPQDTGPYIEHYLIQSQENILSLESSRFKFGSIPALIAHYAQCCDELPVQLMLP
RVLREANNRKKLSSLALLGQEFWRYASSPVVLGPPVAAKTITAAITTATCTEQQQQQQQQ
QQQQQQQQLLDAKSPLSLTETSGLGTATFFSDALAGKPAAVAPPQSMFSPTGSGQLLGFF
SQAGTPSDTNSSMSSFSTSGGQHMQLLSPNSVDSVILTMSPVDAQGYLPGGAALEPPMQP
MQPHGSNNLSTFKTTSAAVASITELEQVRPQRPKPPNTLNLKPPAPPMRWSKPHSPDQLG
NNFTVTTTVTFSMENNNGSNNGANNGGSKPNPAQFVEVTTPASSNPFNALLNSQASTSTF
QTFAKRLSPEGECKDTLSSQGSSSNDSRWHQSQRKMLSPMTPNSAGLMPGGGGGGGGGGS
SSSKSRKSRNRKESKHYQESDILESPPAQYCASALSDKISDYEDVWTHDPSDRASLLTSF
KPGLDAPGVLNRRPDLLAETPSTPTQQLLSPCEEGSGNHDTSQQLLQFSGDAQPRSRAGL
LLPNLTNAGAAPLMTQSLTEQSGGDDGGDTTPTAAQTPGSRSKQGSPFYAEPADALRQAG
FTSAAAAILRRQQRSQLLPANQRHSEPLKGGLATTAAPLLLPAELEKLAGSLDELKQKPK
PMAMAQQPAKRGRNRIEHWQLDSSWEFMAKQETNGGDYDTAADWQEKENSLGRDKDAAGT
KKRPLTVHQIIAKRLPDLNLPELVRCSTPPQTQAMQTQTTTAPLQEKANVDGSQKSFQSQ
NGCRLSAYDNVERNCAAFCQTYYAGIDSAQSDDGTVFSEPWDSSQWDSFMPMQDDATINS
DSIHLSKCRPALSEDDTIIEEFSSTKDGSNSSCNQDTLKANKNATGAGAGSNNNNNNNNK
AIRPKVATILRNPSMRDREILCHPRNKINVQSVGPGDSLRAYTLQLAQDPSSTFARNIEN
FISCTKESREAAPQVVMRNMRQFMSGMKNYLVKHGEGKFHAELESARARLKSDEFLNLDA
MLETVMHQLVVLPLREHLYGIFVDYYKRSEDIQLLAQNVRYACERDATDFGIRATVTPPS
QTALRLIANLLWKLQEAELPLDKLELFLCVISTVFDATGCPRGQQLGADDFLPVLVYVVA
KCGFVGAEIEAEFMWGLLQPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWRS
SCLPACSSVLRVIIPDECNGSLQTRTLPVRPHTTTREVCRIIAHKARITNPQDYALFKLV
DGEETLLTDAECPQDARLAAKGKHCMLAYKRIDAKIAWPTAAQPGSH
Download sequence
Identical sequences FBpp0229133 7244.FBpp0229133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]