SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0229527 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0229527
Domain Number 1 Region: 41-186
Classification Level Classification E-value
Superfamily EF-hand 7.55e-44
Family Calmodulin-like 0.00000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0229527   Gene: FBgn0202307   Transcript: FBtr0231035
Sequence length 190
Comment type=protein; loc=scaffold_12963:2513130..2513702; ID=FBpp0229527; name=Dvir\GJ15110-PA; parent=FBgn0202307,FBtr0231035; dbxref=FlyBase:FBpp0229527,FlyBase_Annotation_IDs:GJ15110-PA,GB_protein:EDW63457,REFSEQ:XP_002051302,FlyMine:FBpp0229527; MD5=210f086f305858962d9ae661d69f62f4; length=190; release=r1.2; species=Dvir;
Sequence
MEPNVTAVNVAAAPAAVTAAATAPNTKRGTQQGRKKSGPKFELTEAQKSDIKEAFDLFDN
ECTGYIEVKELKVAIRALGFEPKKEEIKRMIAEIDKDGSGRIAFNDFLHLMTMKMAEKDT
KEEILKAFRLFDDDETGKISFKNLKRVARELGETLTDEELREMIDEADLDNDGEVNQEEF
LRIMKKTSLY
Download sequence
Identical sequences B4LQS3
FBpp0229527 7244.FBpp0229527 XP_002051302.1.90633 XP_015028164.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]