SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0229859 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0229859
Domain Number 1 Region: 90-159
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.88e-16
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0229859   Gene: FBgn0202635   Transcript: FBtr0231367
Sequence length 263
Comment type=protein; loc=scaffold_12963:join(3323018..3323353,3323410..3323865); ID=FBpp0229859; name=Dvir\GJ15442-PA; parent=FBgn0202635,FBtr0231367; dbxref=FlyBase:FBpp0229859,FlyBase_Annotation_IDs:GJ15442-PA,GB_protein:EDW63545,REFSEQ:XP_002051390,FlyMine:FBpp0229859; MD5=50bd027beeb119af46e254f481f57e99; length=263; release=r1.2; species=Dvir;
Sequence
METSSSTSASSSSSSSISTRQLRRNFNMESLSISEPADGDEEQDFTFRYPSYMYPDVEYD
KHDVPLSFRATPDSLFNLCAAAVDAQARTEVFKWSINDVAEWLREFGYPEYEETFRQNYI
DGHKLLNLDAIALVALNIRDFEHIRHLGRGIRALYRKELQTATQTKHQSEVYKSFRFRTG
RKYEGLRETELLGRMHMLRSVFQDINDWELMELHMARKPVRRYREVLASSRRYNLYGPTA
ARRSPLTMDDGDTTAWYNFGNCY
Download sequence
Identical sequences B4LR81
FBpp0229859 7244.FBpp0229859 XP_002051390.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]