SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0229880 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0229880
Domain Number 1 Region: 84-152
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000497
Family Antifungal peptide scarabaecin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0229880   Gene: FBgn0202656   Transcript: FBtr0231388
Sequence length 819
Comment type=protein; loc=scaffold_12758:complement(855967..858018,858075..858410,859609..859680); ID=FBpp0229880; name=Dvir\GJ15463-PA; parent=FBgn0202656,FBtr0231388; dbxref=FlyBase:FBpp0229880,FlyBase_Annotation_IDs:GJ15463-PA,GB_protein:EDW58280,REFSEQ:XP_002060069,FlyMine:FBpp0229880; MD5=5f1b9da838dcbf4e67eb75c1bf7d0fb2; length=819; release=r1.2; species=Dvir;
Sequence
MWKFVCLMLLLATGCSAGPLAQQQRKNMPIVAREDSAPAVQESDMEAEAEPEMTASGSAA
EAAPLAGTLTLPSNATSIRADITDNFSCANKSYGYYADVENDCQIFHVCLPVTYADGKEN
TFRWSFICPEETIFSQESFTCMRREDMTIECEDSSRYYELNGNFGLPMEEEKENANKPGA
AAATESEEPDQPEESEVPAPSEPAAAVATPEPAKPVKVQKPKPKPNRRKPAVTYNKPAVV
YNKPQRKAPVVATAAPVVEPIVESEPEVVIVPVQQASKHPKPQRFSVRPNKDKPKPVVPA
TAAPVRNELFNAIRKRPAIFNKNSVSSTAKPVQEATEASVTEEVVQAELNEPQPTLKLQT
IFVEPVAQASEPVVAIAQPELDAEPEPEEPEAEPEQTKLKEPMEEASPMPEQMLEMKPIE
AIPEIPAVIVESLAEKPQEIENKPQMEVVAEDSAMEPAIMEPSGSGEESLNNIEALEAAK
PADAPVSLPATPEMANPSPLVEEMLDNNSEVQESLGGFKPVDPAMAAEAEQLITDFLNTL
RKHEKKTETELANAAMDIAETVEQQQPQNQEIDSNPAIEETEAVSIEEAKLPEPDKVDPI
ASVEEQLLETETKQKQKPDSPIINIMQLNHLPADYQIPVQVVAAPEPEPEAAEESAKETE
VKEAIQDDAQESLASAAYMPGISIDDIVELVKERLDQNPKNEQLTPMELVLTPGAAAPMT
LIESTAEQKPEREQSAPAAALIVEPAPAAAEEDGPILPIYKRVSVADPAMSAAQTQPVTV
SKVEGEATPQQEVIEVREPKSQTRMDARKRRFLFRADAS
Download sequence
Identical sequences 7244.FBpp0229880 FBpp0229880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]