SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0229904 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0229904
Domain Number 1 Region: 277-543
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-80
Family Protein kinases, catalytic subunit 0.0000000533
Further Details:      
 
Domain Number 2 Region: 160-306
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-34
Family SH2 domain 0.0000397
Further Details:      
 
Domain Number 3 Region: 97-209
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-22
Family SH3-domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0229904   Gene: FBgn0202680   Transcript: FBtr0231412
Sequence length 554
Comment type=protein; loc=scaffold_12758:complement(202489..203103,203171..203478,203540..203793,203858..204077,207012..207279); ID=FBpp0229904; name=Dvir\GJ15487-PA; parent=FBgn0202680,FBtr0231412; dbxref=FlyBase:FBpp0229904,FlyBase_Annotation_IDs:GJ15487-PA,GB_protein:EDW58247,REFSEQ:XP_002060036,FlyMine:FBpp0229904; MD5=5912147364f5fd3d8c97ca60f06d1b7a; length=554; release=r1.2; species=Dvir;
Sequence
MGNKCCSKRQDQELALAYPTGGYKKSDYTFGQTHINSNSSVGAGVVAALGQKHNNGGSLD
SRYTPDPNRGPLKIGAKGGVDIIRTRTTPTGVPGGLPKRRVVVALYDYKSRDESDLSFTK
GDRMEVVDDTESDWWRVVNLTTRQQGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLA
EENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGFYIATNQTFASLQ
ALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEV
FYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEY
MSNGSLLDFLREGEGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVA
KICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQ
VPYPGMHSREVIENIERGFRMPKPTIHYFPDNIYHLLLQCWDAVPEKRPTFEFLNHYFES
FSVTSEVPYREVQD
Download sequence
Identical sequences B4MFY6
FBpp0229904 7244.FBpp0229904 XP_002060036.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]