SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0230231 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230231
Domain Number 1 Region: 25-92
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000915
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 91-161
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000246
Family Tachycitin 0.019
Further Details:      
 
Domain Number 3 Region: 168-225
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000262
Family Tachycitin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230231   Gene: FBgn0203001   Transcript: FBtr0231739
Sequence length 230
Comment type=protein; loc=scaffold_13042:join(545040..545091,548171..548386,548460..548654,548724..548953); ID=FBpp0230231; name=Dvir\GJ15814-PA; parent=FBgn0203001,FBtr0231739; dbxref=FlyBase:FBpp0230231,FlyBase_Annotation_IDs:GJ15814-PA,GB_protein:EDW66044,REFSEQ:XP_002057936,FlyMine:FBpp0230231; MD5=a54fda70fb650454ac93319d5056e399; length=230; release=r1.2; species=Dvir;
Sequence
MGSVQLSCVLILALIAYGHGLAVGTPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCE
NGLLFDGKGAVHNHCNYNWAVDCKGRHWDPTPISTPGCEYQFGLYAVSKECSTTYIKCAH
GEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRF
PVQGDCHRLITCVEGYPRLISCGEDKVFDEHTLTCEEPEYASGGCANYGK
Download sequence
Identical sequences B4M9Y5
FBpp0230231 7244.FBpp0230231 XP_002057936.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]