SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0230571 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230571
Domain Number 1 Region: 37-87
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000994
Family Tachycitin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230571   Gene: FBgn0203339   Transcript: FBtr0232079
Sequence length 440
Comment type=protein; loc=scaffold_13246:complement(1773536..1774842,1774904..1774919); ID=FBpp0230571; name=Dvir\GJ16154-PA; parent=FBgn0203339,FBtr0232079; dbxref=FlyBase:FBpp0230571,FlyBase_Annotation_IDs:GJ16154-PA,GB_protein:EDW71269,REFSEQ:XP_002059211,FlyMine:FBpp0230571; MD5=18b6568330276da541ca1edde4a087f7; length=440; release=r1.2; species=Dvir;
Sequence
MRAHYVLLASLSLLIVATGAANIRSSASNDLYRRVVCTNKPNGFRALQPGSCSAYYECVG
GVAVQKACARFFDSKSQQCVNYNTGCSEVLQLSDTKAIGGSAVTAAPCDTTTPPCEETTS
TICTSPTTTTCSSTTASTTTCTTPTTTTSTTTTTKTTTTTTTTTKATTATTTTCTTPTTT
TCTTTTTTTTTTTTTTTTTTTTTTTCTTPTTTTCTTTTTTTTTTTTTTTTTTTTTTTTTT
TCTTPTTTTCTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTTPTTTTCTTTTTTTT
TTTTTTTTTTTTTTCTTPTTTTCTTTTTTTTTTTTTTTTTTTTTTKTTTTTTTTTTTTTT
TTCTTPTTTTTTTTTTTTTTKTTTTTTTTKPTTTTTTCTTPTTTICTTPKTTTCTTPPTT
PCTTPETTTCTTLTTTACAK
Download sequence
Identical sequences 7244.FBpp0230571 FBpp0230571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]