SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0230632 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230632
Domain Number 1 Region: 2378-2694
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.28e-44
Family NodB-like polysaccharide deacetylase 0.01
Further Details:      
 
Domain Number 2 Region: 57-110
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 3.66e-16
Family Tachycitin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230632   Gene: FBgn0203400   Transcript: FBtr0232140
Sequence length 2766
Comment type=protein; loc=scaffold_13246:join(150485..150554,169694..170244,170311..170507,170768..173293,173804..174290,174379..174425,174795..175101,175960..178757,180188..180274,180333..180526,181085..181310,181537..181974,182034..182232,182316..182489); ID=FBpp0230632; name=Dvir\GJ16215-PA; parent=FBgn0203400,FBtr0232140; dbxref=FlyBase:FBpp0230632,FlyBase_Annotation_IDs:GJ16215-PA,GB_protein:EDW71173,REFSEQ:XP_002059115,FlyMine:FBpp0230632; MD5=efb82fda7bd7669919c6890462be90a8; length=2766; release=r1.2; species=Dvir;
Sequence
MQFSTHRRSLYWLLGLCLLLFETGLTNAQSKRTPRVTNSRSFSTNVKSTSSNGVSFDCPE
EFGYYPHPTDCTQYYVCVFGGALLESCTGGLMYSHELQTCDWPRNVGCELVDSGTSATST
EVGNASRNKPQQHVPSRIRFGAAFTSPAATQKTITVPPQYHRSPPQIIPAQVQHIPPPPE
LAVSPNPVVTSRGQPKSLLDSQEEIAKLYAEAQETLPPVEEEESDRQQRVYRGQPSTVSQ
VQRDRDGILHQASINAIPNHGKIGSYTFGTAYSESLDDDVIIEHELSHNRLDVYRRRKRR
DVSGLMLTTPEETSVPTEIPNDSNTSSEVMESDSANSTQQGSGETTNNSNNSNNSQEQYD
EAAPLVSQLQKYSSKISQSEIGFPYTDADYSEHVEDNNDTVTGESKRRARQLRPFPHAAV
KWPAHGYRSVDPPFQQPYIQKNSYSFGSFNPYLTPPSQQAHTNQNYNKLNPGPGYKAYPQ
QPQQQEPVAPYGKKPTLVYTGYNLSLPPPPLEDDFRPIAGNYYGAASSTSSRPPGGYQEE
TSQADLLPYLIQQLKELKERRKQIQTENFAYFHLDNQPIAPTTHSTTPRPSFEYFSTTKS
TPQVTPNSHNAQYSTMGGFYNNNPDYVPSTSNYSGKLISQYSITQSPEPQSTTESNYFQY
NIIANQKMKGVYNTAKLNQIDHAAVKVRPPVTPLQVTPNFNIVSAPNLAYNKPNDLQLIP
FRDLSHLPVGISYASNTTIPESYQTFTKSISSTVPPKLDSHKPPTTAKPQMTNFQFNINE
FMANLKASDLASFNPAVNPLIKYFKQVSNDGSGNIRNALILRRPVSSSTPTSTITTRAPF
KSNSTPTKASISSTTQASTTPSLKGYKVFVKNTQNQINKHIPEPNQSTTTSTPRSRNSGS
RTTTTQRTVEYYDEDYDDGVDEDMLPPSRMPPYMPMSETMAPPRPQVTTNVPPTTRASKI
RPSVQTGFMEATTTRRPFPNFLQFNQPNAGIGVPAFISFPSDIFQELKQRLPQLQGSTDV
NTQSTLRVRITNTTSTTTPTTLTTPTRIRYTVRPQRVRGQQKWQVQAVNNPDGLQRKQNE
TGRGAAYAKPGSSNDGLGGQHLNSIHISSNTERQRVESSSPSSLTAQTSDNIFLQPSSQA
SPSQFASNRNYYNTSIFNHGGGYQTPQQAQQQQQPSPFQQPQQQQQQAPALPNPYDSSYY
SVYDDDIDLYRDIEYQQQQEQHQQKSQPYQSTVRQQQQSTYRPLEILTTPTPPQRPSYSS
QPTLSYNTDYDEDLNAQIEQDNVYDQPTRTPQRAEAMTIQALDTRTTASTTERSAARPDG
RNYYDTFTTPITNYEETDYSYSSSAEYAQNLPADYYQSEQTLVKTRPSTQAPKSKNTDDY
YLIANDVAHSTSAFKTTTSPRTTQAPSTKSPTTSTIKKPSLPTYDSNPFLKSKLQFLAKS
LISAVAGSQSQNINDTRTPTQVQSTVTPPFSESWALANDSANSSSTQKYVETIYDETQNV
QNVQGEEISSGRNFDTITSPKFLDFINAAAYGASNLVRAPTEKSFKTLYTRENIYNGLEK
DKAISTEQNQSKRIQSYVLSDVKPQSFRPTINNSSRAASSDLLDSSSTARPNKAYEYSLE
SGSHGFTLKAKESLNEENVSEPLFERPESGQRLKPSTTTTTTRLPHTLVNHVSTENEDII
PTTYAPLRIWRNGRPTIKQTHRKPTKMPLLSVTDLSSTTAKATTTTIKAPNTFSSSTERA
SSGQSFTSRANIFKDNLNRATSNPGMRFVSPYKSLESLLQDERMPHNSLRTTTRTRYANA
PASIPFLQTTPKSTHNSFPTNIIQNNATQIVLETMTNGNMRNFSISDVILSTFSPQRPSL
PRATTTTTAKTTTTNKIPTEAALTTTILEPTVATVVTSPSIQVSEIAVRARGRSRYTAAT
ISYNLDSVDEPTTYAPKFKIPNSYELRSSTSKPLLRRKAHRGRAATSLRQTISEPTARSG
EKYETYKAAQKAKETVYRYQIAPSSAKPITAEDTSSLKRNPNENEALISDTPRAEALIAQ
QPLENKHNNSIEQSISTETSASSIQDVHIITDRPPVKYLYSNKYRQKTAERTLADSLQNA
GYITTANGRTKFRATNVLEQLQHFLSASDSDESGSSQFVDEVYGSEIKASVNEITPGFST
NRSAMTTMRSTTAMSASLPTTRVPLFAFKSTGNPSKSYTPTPTISIIETDATKANISIPD
ISTEPVPSTTTATPSVTISSPPTTRVSRVNNALKSSIAAAAAQSSSPVSTSSTYQMPGGR
ANKFQYGLASNSNNNQHQYNNNNAAVAAVSVKCSDSTLSPKCNEIPSRNNNRNRGSSIFT
NQDRDTAATPNRGTHPPRTRPTLKPAGTIVSKAQEFVDIYRYPPSRPDPLYPQPTPDKTA
AKCRKDVCLLPDCYCGGKDIPGELPVESIPQIVLLTFDDSVNDLNKQLYTDLFEKGRVNP
NGCPITATFYVSHEWTDYSQVQNLYADGHEMASHTVSHSFGEQFSQKKWTREIAGQREIL
AAYGGVKLSDVRGMRAPFLSVGGNKMYKMLYDSNFTYDSSMPVYENRPPSWPYTLDYKIF
HDCMIPPCPTRSYPGVWQVPMVMWQDLNGGRCSMGDACSNPSDSEGVTKMIMKNFERHYT
TNRAPFGLFYHAAWFTQPHHKEGFIKFLDAINAMQDVWIITNWQALQWVRDPTPTSRINS
FQPFQCDYSDRPKRCNNPKVCNLWHKSGVRYMKTCQPCPDIYPWTGKSGIRSSRIDNEVE
EPSAQN
Download sequence
Identical sequences 7244.FBpp0230632 FBpp0230632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]