SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0230666 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230666
Domain Number 1 Region: 29-88
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000139
Family Tachycitin 0.028
Further Details:      
 
Domain Number 2 Region: 220-265
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000314
Family Tachycitin 0.029
Further Details:      
 
Domain Number 3 Region: 274-323
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000262
Family Tachycitin 0.017
Further Details:      
 
Weak hits

Sequence:  FBpp0230666
Domain Number - Region: 89-141
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00011
Family Tachycitin 0.085
Further Details:      
 
Domain Number - Region: 149-209
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00628
Family Tachycitin 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230666   Gene: FBgn0203434   Transcript: FBtr0232174
Sequence length 381
Comment type=protein; loc=scaffold_13246:join(1247367..1247373,1247438..1247994,1248068..1248649); ID=FBpp0230666; name=Dvir\GJ16249-PA; parent=FBgn0203434,FBtr0232174; dbxref=FlyBase:FBpp0230666,FlyBase_Annotation_IDs:GJ16249-PA,GB_protein:EDW71236,REFSEQ:XP_002059178,FlyMine:FBpp0230666; MD5=aaaad3712ebf3a1b138888589c54c107; length=381; release=r1.2; species=Dvir;
Sequence
MSGMYLLASILCLAVAGSLAESILEGNYNVTALCTSVKYGVQVGSLESCDYYYVCTPSGP
VKTNCQAGYAYNYVTQTCSPEAQVNCYYGVENPCAGSTGDKWVPVAGTCNQWIYCKNGVN
SGQGSCGALSFDPTSQNCTYAPCNTLPDSEINYCNVVPPGIYFGTTTDCRTYNYCYPNGK
LASANCEFAFLVQQGGCGYNTGSNCDRVVTEAVPNSCDNAGDVEPNNSTCGSYYYCNGKN
YVTMSCPIGQYFDTILEKCVARQQAVAAEGCNRCQYANTAFVNNVNYESCNTYYYCSNGV
NGPVTNCPSGYYFNESEQGCASMSELGSYVTNNGACHGAQAPDTTTGAPSSDSTNSEQTE
LSTASDAPTKSTATTENSAGK
Download sequence
Identical sequences B4MDH5
XP_002059178.1.90633 FBpp0230666 7244.FBpp0230666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]