SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0230714 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230714
Domain Number 1 Region: 76-143
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000957
Family SAM (sterile alpha motif) domain 0.079
Further Details:      
 
Weak hits

Sequence:  FBpp0230714
Domain Number - Region: 150-218
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00445
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230714   Gene: FBgn0203481   Transcript: FBtr0232222
Sequence length 354
Comment type=protein; loc=scaffold_13246:join(2324383..2324676,2325412..2326182); ID=FBpp0230714; name=Dvir\GJ16297-PA; parent=FBgn0203481,FBtr0232222; dbxref=FlyBase:FBpp0230714,FlyBase_Annotation_IDs:GJ16297-PA,GB_protein:EDW71317,REFSEQ:XP_002059259,FlyMine:FBpp0230714; MD5=042a119ff7ae0b103f56fe06bd2b7900; length=354; release=r1.2; species=Dvir;
Sequence
MPYLYGIADTKFLVGKGILKKKTKQNEYPPIKFRNHPQNAGHVKFDRNAWPIQFRVQPDS
LVELCVNVVDKLPLPSVYEWNDMDIRRWIKSYGYPQYMNTFRVNMIWGRKLLLLDADALA
AMNIKDFEHIKHITYGIRMLFHFELAKFSRSISLPDENPNELYLLWHTQTGLNYDAVRRS
DLYRRMQLIRERALNLDHWDMLEMWLRRERERKYTELIALVPRRNMYRCPQRATEVASET
ESLTIEDPICHVCIPPCECEWRERDTRLPWRIKCIKPSTIALPATHSKWIAHQNTCVHCI
PPCECRWPSRYYLTGTVIRCLQHSFPEKFAPIFDERITTVVRPSLVERWTRFSI
Download sequence
Identical sequences B4MDQ6
7244.FBpp0230714 XP_002059259.1.90633 FBpp0230714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]