SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0230971 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230971
Domain Number 1 Region: 212-306
Classification Level Classification E-value
Superfamily Ras GEF 0.0000000693
Family Ras GEF 0.017
Further Details:      
 
Domain Number 2 Region: 30-101,145-197
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000619
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.082
Further Details:      
 
Weak hits

Sequence:  FBpp0230971
Domain Number - Region: 76-145
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0778
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230971   Gene: FBgn0203738   Transcript: FBtr0232479
Sequence length 323
Comment type=protein; loc=scaffold_12963:join(5916045..5916155,5916221..5916462,5916518..5916663,5916731..5916879,5949535..5949716,5949769..5949910); ID=FBpp0230971; name=Dvir\GJ16554-PA; parent=FBgn0203738,FBtr0232479; dbxref=FlyBase:FBpp0230971,FlyBase_Annotation_IDs:GJ16554-PA,GB_protein:EDW63775,REFSEQ:XP_002051620,FlyMine:FBpp0230971; MD5=ce0c178d170926b9c09fd305163b950f; length=323; release=r1.2; species=Dvir;
Sequence
TISRIKRKIYEINEQQVILNENKFGPLDNNSVVIVIQVHKQFSYLRYSVNSLSHARDISK
ALLVFSHEFYDDNINDFVQAIEFCKVIQMYYPHSLQTHPHKFPGRDPNDCPRNITKNIAI
INNCNNALYPDINGHYRQAKLTQAKHHWWWKANRVFHQLKATRYHAGLVLFLEENHFVAE
DFLYVVTKMQQNRQKLCPQCNILRLGNHIITLKFSKEFLFSFLLLSRLYLRPQKLLGKLL
DSVPERLETLVALLTEWTAKYPYDYRDERMMNHLKGECCTSHLEAIVFQILNALLNRLTE
LEQYEVDLRACQTNRTDMVSSTQ
Download sequence
Identical sequences FBpp0230971 7244.FBpp0230971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]