SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231099 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231099
Domain Number 1 Region: 372-477
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.33e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 220-274
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000524
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231099   Gene: FBgn0013135   Transcript: FBtr0232607
Sequence length 1092
Comment type=protein; loc=scaffold_12928:complement(369409..369459,369937..370077,370145..370381,370439..371850,372327..372683,373144..374132,374203..374294); ID=FBpp0231099; name=Dvir\per-PA; parent=FBgn0013135,FBtr0232607; dbxref=FlyBase:FBpp0231099,FlyBase_Annotation_IDs:GJ16682-PA,GB_protein:EDW62292,REFSEQ:XP_002056806,FlyMine:FBpp0231099; MD5=305c99a4ade1782191fd64133ce38ef7; length=1092; release=r1.2; species=Dvir;
Sequence
MEGESTESTHNTKVSDSAYSNSCSNSQSQRSGSSKSRLSGSHSSGSSGYGGKPSTQASSS
DMAVKRNKDKSRKKKKAKSPAQATAATTTTIKSLEQTEEPLLVKPNNGSCEQQLELQDAQ
QLGAPTPSDAHDAHGDKPQLDVDEQQDDPQAEQIQQLETATAATISPDTMSASVTVTIDG
CTSMEKTCEWTDRPGRLEAHAACIGKQQLQQQQHDRVKEDSFCCVISMHDGVVLFTTANL
NEMLGYPREMWLGRSFIDFVHIKDRATFASQITTGIPIAESRCSQSKDARTTFCVMLRRY
RGLASGGFGIIGRPVSYAPFRLGLTFREAPEEVQPDGCTLSNATSMLLVISATPIKSCYK
EPDEFLSPKGPKFAIRHTAAGIISHVDTAAVSALGYLPQDLIGRSILDFYHHEDLSDIKD
IYEKVVKKGQTVGATFCSKPFRFLIQNGCYILLETEWTSFVNPWSRKLEFVVGHHRVFQG
PKQCDVFEMSPNVTPNIPEDEQNRNACIKEDILKMMTETVTRPSDTVKQEVSRRCQALAS
FMETLMDEVARGDLKLDLPHETELTVSERDSVMLGEISPHHDYYDSKSSTETPPSYNQLN
YNENLLRFFNSKPVTAPVDTDPPKMDSSYVSSAREDALSPVHGFEGSGGSGSSGNLTTAS
NVRMSSVTNTSNTGTGTSGGENSASGSSNPLPVNMTLTEILLNKHNDEMEKCMLKKHRES
RGRTGDKTKKSVIEKMPEYSGPGHGQTMKRGGSHSWEGDANKPKQQLTLSAVVVAPTVSV
SPAEDSQTTAKWQAPMTGSHLFQSSYNFPQSINLWPPFSLGLTTPTVHTTHTSMAQKSFS
PQHNLFPAFYYIPAPLATATAGSAAAQTSVSSASAAQHSPKSSENPSTSQPEATAATAMP
MPYMAGVMYPHPSLFYAYQPMPFPSVSGAVQMSVQSSGSQSNNNNKSIYTAQQVKMAPAS
TTTQKPGAFHSITPAELNKPDAPDTLLHTETSPKISVQEAPKKELSDLPSTSARRGSSSD
QRNNSNNPKKYTDSNGNSDDMDGSSFSSFYSSFIKTTDGSESPPDNEKETKVHKLKPIVE
HPEEDQTQHGDG
Download sequence
Identical sequences B4M816
XP_002056806.1.90633 XP_015025535.1.90633 XP_015025537.1.90633 FBpp0231099 7244.FBpp0231099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]