SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231354 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231354
Domain Number 1 Region: 22-106
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231354   Gene: FBgn0204116   Transcript: FBtr0232862
Sequence length 129
Comment type=protein; loc=scaffold_12928:join(4823747..4824005,4824086..4824216); ID=FBpp0231354; name=Dvir\GJ16937-PA; parent=FBgn0204116,FBtr0232862; dbxref=FlyBase:FBpp0231354,FlyBase_Annotation_IDs:GJ16937-PA,GB_protein:EDW62643,REFSEQ:XP_002057157,FlyMine:FBpp0231354; MD5=fc6541fe16d1e2b2bc43eafbbe0ee68a; length=129; release=r1.2; species=Dvir;
Sequence
MHTLTHKLFYLVAYICLLLCTSYRWFHPTISGIEAEKLLQEQGYDGSYLARLSSSNPGAF
TLSVRRGNEVTHIKIQNNGDFFDLYGGEKFATLPELVQYYSENGELKEKNGQAIELKQAL
ICAEPTTER
Download sequence
Identical sequences FBpp0231354 7244.FBpp0231354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]