SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231355 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231355
Domain Number 1 Region: 339-410,546-753
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.87e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000156
Further Details:      
 
Domain Number 2 Region: 215-322
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-33
Family SH2 domain 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231355   Gene: FBgn0016496   Transcript: FBtr0232863
Sequence length 994
Comment type=protein; loc=scaffold_12928:join(4835147..4835820,4842198..4842360,4844072..4844251,4844330..4844447,4844535..4845448,4845525..4845615,4845952..4846141,4846206..4846747,4846819..4846931); ID=FBpp0231355; name=Dvir\csw-PA; parent=FBgn0016496,FBtr0232863; dbxref=FlyBase:FBpp0231355,FlyBase_Annotation_IDs:GJ16938-PA,GB_protein:EDW62644,REFSEQ:XP_002057158,FlyMine:FBpp0231355; MD5=c116bc93c272cec2f70c788e720fa177; length=994; release=r1.2; species=Dvir;
Sequence
MLFNKCLEKLSNSLGHVVNHKLQEKQVYNSNNSNDNDNNNNSVYNKQRNFEYERAIQAHY
GNGRTRSHTKSKASKGHKSKATAATAPTTTTATTAATNTSECKNCMSNDELAMIIRGVAH
NNSNNNKHKYSSRTHRRRPSTYIGASSSCSSTESLHLHLAMAPRGSNCSGSSSSNNSSDG
HAYSSYPVTPTSWSASPPSFGPNFGDSSGTLALLAAMRVQLYGYTWFHGNLSGKEAEKLI
LERGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRWQDKKYDVGGGESFATLSELIEH
YKRHPMVETCGTVVHLRQPFNATRITAAGINARVEQLVKGGFWEEFESLQQDSRDTFSRH
EGYKDENRLKNRYRNILPYDHTRVKLQDVERSVPGAEYINANYIRLPTDGDLYNMSSSSE
SLNSTVAACPACTAAQTQRNCPNCHLLNKTCVKCAVKSATLPTNCATCNRKSDSLSKHKR
SESMSASANASAAGTGPGTPTAAGNTSAAAALNGCLAVLLKKHCGDASPPPSTTSSCSGP
LTGSLLNGEGNQFKTYIATQGCLANTKTDFWNMIWQENTRVIVMTTKEIERGKTKCERYW
PDEGQCKQFGHAKVHCIKENSTNDYTLREFLFSWRDKPERRIYHYHFQVWPDHGVPADPG
CVLNFLQDVNTKQSSLAQAGEKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTEID
IQRTIQMVRSQRSGMVQTEAQYKFVYYAVQHYIQTLIARKRAEEQSLQVGREYTNIKYTG
EIGNDSQRSPLPPAISNLSLVSCKSAVAEPLTAAAAAAAVAANAGNKHAAKLQPPLPPLG
ASNNNNSSGNSGSYCNSSSSSSTAQHNGVVSSSNNCSSGSGSANSSNANGNGNILGNGSN
MRKSNFYSDSLAALKLQQQQLHDAATAAAAAALASAAAPAATTTAASASAAAAAAAAAKY
KNIPKDMNSLRQPHAAYVAAAPALPPPPTPPRKT
Download sequence
Identical sequences FBpp0231355 7244.FBpp0231355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]