SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231363 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231363
Domain Number 1 Region: 268-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000095
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 76-129
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000138
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 3-63
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000109
Family HLH, helix-loop-helix DNA-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  FBpp0231363
Domain Number - Region: 301-323,400-449
Classification Level Classification E-value
Superfamily ARM repeat 0.0239
Family MIF4G domain-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231363   Gene: FBgn0204124   Transcript: FBtr0232871
Sequence length 709
Comment type=protein; loc=scaffold_12928:join(4957143..4957308,4957580..4957937,4958358..4958550,4958616..4958847,4958908..4959813,4960112..4960251,4960317..4960451); ID=FBpp0231363; name=Dvir\GJ16946-PA; parent=FBgn0204124,FBtr0232871; dbxref=FlyBase:FBpp0231363,FlyBase_Annotation_IDs:GJ16946-PA,GB_protein:EDW62655,REFSEQ:XP_002057169,FlyMine:FBpp0231363; MD5=6db4b9dbd5ad537d5aca90b1a9a46551; length=709; release=r1.2; species=Dvir;
Sequence
SGREARNRAEKNRRDKLNGSIQELSTMVPHVAESPRRVDKTAVLRFAAHGLRLKYVFGKT
LHQQRPQVTDTLMGMLDSFFLTLTCHGQILLISSSIEQHLGHCQTDLYGQSILQITHPED
HEMLKQQLIPTELENLFDAHAEPTDADGEPRQRSKSEEDYIDRKLRDDRRSFRVRLARAG
PRSEPTAYEVVKIDGCFRRSDEAPRGIRSNTFSSSLQLIRRTRGRDDAIPLHTISGNDIV
LTACARIIRPPKIVNRLFDANTLEYRTRHLIDGRIIDCDQRIGIVAGYMTDEVRNLNPFT
FMHNDDVRWVIVALRQMYDCNSSYGESTYRLFTRNGNIIYLQSKGYLEIDKETNKVHSFV
CVNTLLGDEEGKRRVQEMKKKFSVIINTQIPQSTIDVPASEHPAQLEKAVLCLIQNLQSC
GSDQDNDRLDADDDDDDDDTDDDIEDAMSSITNFSHASQSHDPQQQQHHQHHHHRHGHGH
GHGHHSHHNFLDSTMSQARLGAGNGMGSSKTPPLALVPPETASVKSSISKSVSVVNVTAA
KRLRALHATSAAQSPSSKSTSCSCLGVGDSDCDYCQSPLTPESVMGSTSVSLKRSSAASS
QDGQDDMLLAKRLFMPSTVITHVLGSSLEQMERTLDQQLSAAVQLREQNNRYDVPHANER
IDEIMEEHQKQSKLFVDIKSEYEELQNKAANSTKTDAESQSSNSNSGIP
Download sequence
Identical sequences FBpp0231363 7244.FBpp0231363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]