SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231497 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231497
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000889
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 205-279
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000994
Family Tachycitin 0.04
Further Details:      
 
Domain Number 3 Region: 142-208
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000196
Family Tachycitin 0.019
Further Details:      
 
Domain Number 4 Region: 25-74
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000288
Family Tachycitin 0.078
Further Details:      
 
Weak hits

Sequence:  FBpp0231497
Domain Number - Region: 273-322
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000141
Family Tachycitin 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231497   Gene: FBgn0204257   Transcript: FBtr0233005
Sequence length 329
Comment type=protein; loc=scaffold_12963:join(7659720..7659726,7660227..7661209); ID=FBpp0231497; name=Dvir\GJ17080-PA; parent=FBgn0204257,FBtr0233005; dbxref=FlyBase:FBpp0231497,FlyBase_Annotation_IDs:GJ17080-PA,GB_protein:EDW63883,REFSEQ:XP_002051728,FlyMine:FBpp0231497; MD5=0138aec1f60f0afb976c42ec828a4956; length=329; release=r1.2; species=Dvir;
Sequence
METGSSLVALLILGLCGLGQSQRIEDICTLFSNNTVIRDPESCSRSITCIDGKSVYSTCK
GTTPFFDKDTLKCVKTLDGSDSCDVTCANATGLFISDPKSCFGYYYCMDEETPVYGACPD
STHFNETIQECTWSHASECKASSFDYCSIIKNGVNFDNLQGCNRYHVCTKGELKDETCKT
GYYQARTGTCVDKNLVECDVHPLPSNVCGTAKSPKKNELVPDGATCQGYFFCAEQANGTP
DENPTWGKCGDDLFFDKSSQKCIEPNKVVCSEDRCQGRTIPFVLSSTKGCRHYLRCADGR
TIDEKTCGNYFFDEANAVCVAQILTYAIC
Download sequence
Identical sequences 7244.FBpp0231497 FBpp0231497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]