SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231627 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0231627
Domain Number - Region: 73-119
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00111
Family SAM (sterile alpha motif) domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231627   Gene: FBgn0204387   Transcript: FBtr0233135
Sequence length 261
Comment type=protein; loc=scaffold_12963:join(8435042..8435707,8435769..8435888); ID=FBpp0231627; name=Dvir\GJ17210-PA; parent=FBgn0204387,FBtr0233135; dbxref=FlyBase:FBpp0231627,FlyBase_Annotation_IDs:GJ17210-PA,GB_protein:EDW63984,REFSEQ:XP_002051829,FlyMine:FBpp0231627; MD5=20f3f5acde05f696393c2847bdeb6f70; length=261; release=r1.2; species=Dvir;
Sequence
MSAENVPLFSTNVPPAVQFGASKNFQTHTEQQDLDSAFLGYERRPWMQGKVKPNPHRERE
AITTLLSTSNDNVDKLLEENISYRDLASLTDEDLKLFGFAAQNERSKFLKMFALLPNQDP
SYEYICNQNAAQSYNNQIIANASNHIMYLRSSLAATNYKLQVLPPEDVVVGDKRYASRFA
LEALNSVQAISDELSKDLRKLEQLASDANRKSEEGSSMPAKERNVKILYYTAIALGTACA
WLWWWSKRSNSPSLENISVKI
Download sequence
Identical sequences B4LTT3
7244.FBpp0231627 FBpp0231627 XP_002051829.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]