SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231852 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231852
Domain Number 1 Region: 819-877
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000017
Family Tachycitin 0.026
Further Details:      
 
Domain Number 2 Region: 29-80
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000497
Family Tachycitin 0.042
Further Details:      
 
Domain Number 3 Region: 978-1028
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000497
Family Tachycitin 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231852   Gene: FBgn0204607   Transcript: FBtr0233360
Sequence length 1033
Comment type=protein; loc=scaffold_12963:join(12579989..12580046,12580233..12583276); ID=FBpp0231852; name=Dvir\GJ17435-PA; parent=FBgn0204607,FBtr0233360; dbxref=FlyBase:FBpp0231852,FlyBase_Annotation_IDs:GJ17435-PA,GB_protein:EDW64369,REFSEQ:XP_002052214,FlyMine:FBpp0231852; MD5=973b5629cac71e81d7dd924181e8f368; length=1033; release=r1.2; species=Dvir;
Sequence
MHGSLIYVCLLISLFYFSEGKPCPEKSRRHKTRCDAYYKCRDLPSNSHVWIPTKCNEGLV
YEHNVGSCVLPGEDWECITPGELESTSNSLPGKDADIIIVNTEDESGLLLKESSHLQDDD
KSVDIVLDATISSEESEDKKSPALPAQQASEYESSSSSQFDSSGDGELVDLDGQLQAATR
EGEVKIGHNSSQSAPMAMFMEPSSTNSGEHMTFNSQSGSPIDPNLTAHLQRLSQLIDGLQ
QKYQKTDKPQLEMRPDQLNAFLAHFDLKNHFDMINPLGSHMETTAPTTTTKPALASANAE
QPVPLPRPTVNKTLLQEHLTKHRMQPETKLILSSAQPFSSHGQGYANSQIVVNRPEGSVT
FTLPQYGHGSEQAQQNSLAQSHEYNDHEPKVSEETLKTVLELSKQMIAAQNLPKVLPNTA
YNGAFYAPPILQPVILTPHGNPFQQYYPMQNYESQPPPPPPRNHYVHHKKASGYNKKQPS
TTIIHNNVIPVHVSSTSSGEKEVLDTYGNSLGVYPSLNNNHKNNQMDDSNSSNNYYNKFM
TTMTTARPSSGMSVTTMSSQYSGQYAAPYASEFAQTTPRPFEEQPSAATVASYYTPSPHL
DENNAHRVFHAESYPTSMDIGMNMPRPMDGHSPYPMHIDPDRVKIRPNSHKIESMEVEAD
DAINANYVNSNANNNQKNNNRHVLTYSSAGSTDTGMLGMSHQLAPGSYVEQNYAMPQNVA
NAQQQQHDYQAPYMAGMSNSVYSDAVGSNMYSTGGGVGMGAGNSIQMMPGKTKYPSGLGQ
LVNFNGNFISLDVFQKSILPLITQSPSALTELGKVEVITCQAGVRQPNQTDCTRYFVCSK
KDGKVLTYSCPPYTGFNKQTRICDAATYAQCGNMPIFNGYSIEENRRQQMEALKMLAEAK
RRQEATLKSQSIANILKQYGSMQEPAAPAISSGIDQSLLDSYMVSLPEPSSTPRPTPAIA
TLPPISNSSGSVKKRKYYCREGDKIPDQTSISSYFVCYKTAQGQMKGHKMTCSKGLLFCP
RTLMCTLASKCSG
Download sequence
Identical sequences B4LVA9
7244.FBpp0231852 FBpp0231852 XP_002052214.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]