SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231970 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0231970
Domain Number - Region: 30-96
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0152
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231970   Gene: FBgn0204723   Transcript: FBtr0233478
Sequence length 107
Comment type=protein; loc=scaffold_12963:14568029..14568352; ID=FBpp0231970; name=Dvir\GJ17553-PA; parent=FBgn0204723,FBtr0233478; dbxref=FlyBase:FBpp0231970,FlyBase_Annotation_IDs:GJ17553-PA,GB_protein:EDW64607,REFSEQ:XP_002052452,FlyMine:FBpp0231970; MD5=a5992dcd9ed841462205873ee2edcc13; length=107; release=r1.2; species=Dvir;
Sequence
MWCPLQTISLTVCLILCAAAAEGGIIAGHPDELISSPAQYEFHYSVHDSHTGDVKDQFEH
RRGEYVTGRYSLIEPDGHRRIVDYSSDPLLGFNAQVRREPISLITRY
Download sequence
Identical sequences 7244.FBpp0231970 FBpp0231970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]