SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232215 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232215
Domain Number 1 Region: 444-538
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.00054
Further Details:      
 
Domain Number 2 Region: 230-309
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-22
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 322-404
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-20
Family SH3-domain 0.00028
Further Details:      
 
Domain Number 4 Region: 149-214
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-19
Family SH3-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232215   Gene: FBgn0204966   Transcript: FBtr0233723
Sequence length 554
Comment type=protein; loc=scaffold_12963:join(19363940..19364378,19364789..19364993,19365532..19365877,19365949..19366413,19366542..19366751); ID=FBpp0232215; name=Dvir\GJ17798-PA; parent=FBgn0204966,FBtr0233723; dbxref=FlyBase:FBpp0232215,FlyBase_Annotation_IDs:GJ17798-PA,GB_protein:EDW65032,REFSEQ:XP_002052877,FlyMine:FBpp0232215; MD5=aa47563ac55bc7ffaf32415683157c24; length=554; release=r1.2; species=Dvir;
Sequence
MLEYPQRFARNIPNSSSGNANSSPQYPPQLPQHQNYQSCRQLAPGSPAHHQRHSSLSHHQ
HQQQQQQQQQQQLQLQQQHSLQHHRTLSTASSCSAQHKSVTFGQPASSGCPAPIDYSNGG
SSSGNSSCSAGTGNAGQQSMAGNMKHGKSQEDVCYVVAKYDYAAQGAQELDLRKNERYLL
LDDSKHWWRVQNSRNQSGYVPSNYVKKEKPSLFDSIKKKVKKGSGSKTLPNCSPSRQIES
PTMSRRLPPDPAEAIGTAIVKYNYQAQQPDELSLTKGTRILILEKSNDGWWRGQSGNSVG
WFPSNYTTEDCDNDGEIHTYAMAENVLDIVVALYSFTSNNDQELSFEKGDRLEIVDRPAS
DPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNTSGNAGNGNATGSNGANATGNGAGG
GGGGDSMERRNDCNNKQTQPSQPIERPNLAGKSWYYGAITRSQCDTVLNGHGHDGDFLIR
DSETNMGDYSVSLKAPGRNKHFRVHVEQNMYCIGQRKFHSLDQLVEHYQRAPIYTNKQGE
KLYLVRSLPKANGT
Download sequence
Identical sequences B4LTX9
7244.FBpp0232215 XP_002052877.1.90633 FBpp0232215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]