SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232346 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232346
Domain Number 1 Region: 129-199
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000228
Family Tachycitin 0.013
Further Details:      
 
Domain Number 2 Region: 62-129
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000314
Family Tachycitin 0.033
Further Details:      
 
Domain Number 3 Region: 214-262
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000732
Family Tachycitin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232346   Gene: FBgn0205096   Transcript: FBtr0233854
Sequence length 313
Comment type=protein; loc=scaffold_12723:complement(3903004..3903166,3903224..3903620,3904887..3905005,3905604..3905826,3908894..3908933); ID=FBpp0232346; name=Dvir\GJ17929-PA; parent=FBgn0205096,FBtr0233854; dbxref=FlyBase:FBpp0232346,FlyBase_Annotation_IDs:GJ17929-PA,GB_protein:EDW57819,REFSEQ:XP_002057746,FlyMine:FBpp0232346; MD5=02ff38ba87c316208c9cbd573e2f255b; length=313; release=r1.2; species=Dvir;
Sequence
MASLKICIYALLVGTTLAQQRERGNFRVGAGHPPSQRHLPQRTRDPVQEAAEEPKRKQVQ
EYEPSDECPEPNGFYPDNKQCDKYYACLDGVPTERLCADGMVFNDYSPSEEKCDLPYNID
CSKRSKLQTPQPSQHCPRKNGYFGHEKPGICDKFYFCVDGQFNMITCPVGLVFNPKTGIC
TWPDEVGVTGCKSEDIFEFSCPKVNESIAVTHPRYADPDDCQFFYVCVNGDLPRRNGCKL
GQVFDEENKTCDWARKVPDCADWYKDRLTDAELDELENPKPKSTTTKRPARVRGASRRKP
QPKVVKEEEPEEE
Download sequence
Identical sequences B4M9E3
FBpp0232346 7244.FBpp0232346 XP_002057746.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]