SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232558 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232558
Domain Number 1 Region: 448-689
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.28e-53
Family ABC transporter ATPase domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 1251-1473
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-51
Family ABC transporter ATPase domain-like 0.00013
Further Details:      
 
Weak hits

Sequence:  FBpp0232558
Domain Number - Region: 1521-1563
Classification Level Classification E-value
Superfamily SH2 domain 0.0872
Family SH2 domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232558   Gene: FBgn0205306   Transcript: FBtr0234066
Sequence length 1586
Comment type=protein; loc=scaffold_12723:join(715476..715655,715715..715838,715901..716101,716169..716639,716707..716859,717509..717687,717753..717969,718052..718352,718553..718865,718932..719083,719142..719325,720006..720243,720304..720933,721378..722377,722444..722861); ID=FBpp0232558; name=Dvir\GJ18141-PA; parent=FBgn0205306,FBtr0234066; dbxref=FlyBase:FBpp0232558,FlyBase_Annotation_IDs:GJ18141-PA,GB_protein:EDW57532,REFSEQ:XP_002057459,FlyMine:FBpp0232558; MD5=8d9442c96b3aa657d8341ae658d426e1; length=1586; release=r1.2; species=Dvir;
Sequence
MACRCSLFYVFWHKNLLYLKHNWIPLTIICFLWTGVQFSYLHWSNKSNYYKSEEFESKDY
VSLKALYFPGNEFDWIYYGPSTNNVGSLMEHVREELEIPYERMREYNNSVEMELDMQRQC
KGSCFAINFQALPDPRSGWGLKYSLYSNQMRNSPKKRFVNDEEINHLKNDDEYIREGFLT
LQYVIDRQFLRYQQINDNYELLLNVMPNLEVGNSDSSRLINFGTLFSILFCIMLLSTFLV
PFVEEKQNGLKEFLNLVTPMSFLNGLTFFLIRIVFYATFLMLNLIIAWQYGALGLIPFIY
IYILYLLYIVANMSYAYLISVCFSSVFYAKIGGLILLVIPYVFSIVHSLLTNIAFFLFCT
NSFLEGLDVLQTFCNKHRDFESADLFRVIKDDSSRIFTVYVVLISQTVFYAMLYNYLVCV
FPGPGGLKRPFLFILNPDTYKKRQRNEYTTSPRGTHAIIISDLCKKFQTSKRETHIADHL
NMTINNKEITVLLGHNGAGKTTMMNMIMGIVPKDAGKIVVCSERDVASYRHLIGFCPQHS
VFMSYMTCQQHLEFFAQLRGAKLSDARNWAELKLRKLNLKDKANEYGRNLSGGMKRRLSL
GIAIAGNTKIVILDEPSSGLDIESRRELWDILLELRKEKAILVTTHYMEEAEVLGDTICI
LANGKLQAIGSPLELKRKSGSGYRLKLQAHETLFLKEETMKEIFKFIPTAKEENYVKPTL
YICLPYDYRLQFHDMLRNLEKNQYRLGIETISIADTSLETVFLNCAGEYDQVDTPDIGTH
NNAPPLAVQYKRLQHIETPYWQLWLAIFYKKSTFLFNEWLYAVCMLILPILGITCAILLM
HYSSLVTNETALPLRLSQLRTGSVYIYNPTNQNDQLEQLLRQYIQQSGLNDKTLTLRGNN
SVREELLQLQRDNLPYFLEDAIGLIEMVSEERSTSDTPILEVYWASNRYHSSVMLVNMLD
TCMLQLLSRQPEAYIDTTYVPMKQFVSDISAARLEYYVVIVTATMFFSMFYYVALPFREN
ANGFRQLQPMSRYTYWCATFVFDMILHALVCLLLFLVQKVIMPAELYNIEEQQLIVMSIF
FYGCSYLPILYALGNNFKSISTISTYLLLMLNISEIAPLITSSNIQAMQLHGTKIAFLRF
LPDFNLNHQLRIINENLLAQRSKSKNPPETTSEFFAYALTVFTLVMGFFTIVLEHKYYRR
QLKDFFYGKTCKIPPKTGNSNQELECINDCVNEEQHVKQLLDGTAQQASEDYPLIVSNLR
KSYGGKPAVSGISFAAVSGECFGLLGVNGAGKTTTFQMIAANKTVDSGHIRTKGIDIRLN
EVAYRQQFGYCPQNDAINQFMTAEQCLRLMALLRGLRWRGNEPADMENSVNFWLHKMHLL
KYRHVAVRNYSGGTKRKLMAAMAMIGAPSLVLLDEPTTGVDPISRRFLWKCIKDFLAQDR
TVVLTSHSMDECEELCNRLAIMANGKFKCLNNICALKRLSGFTIKLKMKIDTETEANVTT
ITNTLKGQFEDLDLRENHAGTLTYFVRTDDHILWSNVFKIADQYLGDSLSDLVEYYSVNE
CTLEDIFLKFERQSKSLSNSGSENYV
Download sequence
Identical sequences B4M8K6
7244.FBpp0232558 XP_002057459.1.90633 FBpp0232558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]