SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232563 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232563
Domain Number 1 Region: 576-671,708-1072
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-119
Family Ras GEF 0.00000000016
Further Details:      
 
Domain Number 2 Region: 24-189
Classification Level Classification E-value
Superfamily Histone-fold 3.67e-36
Family TBP-associated factors, TAFs 0.0000182
Further Details:      
 
Domain Number 3 Region: 422-583
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-32
Family Pleckstrin-homology domain (PH domain) 0.0000335
Further Details:      
 
Domain Number 4 Region: 215-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-31
Family DBL homology domain (DH-domain) 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232563   Gene: FBgn0205311   Transcript: FBtr0234071
Sequence length 1597
Comment type=protein; loc=scaffold_12723:join(760869..762219,762278..763245,763558..764400,764467..765336,765396..766113,766187..766230); ID=FBpp0232563; name=Dvir\GJ18146-PA; parent=FBgn0205311,FBtr0234071; dbxref=FlyBase:FBpp0232563,FlyBase_Annotation_IDs:GJ18146-PA,GB_protein:EDW57538,REFSEQ:XP_002057465,FlyMine:FBpp0232563; MD5=b4daa8d0aaddefa28706f22814afb70d; length=1597; release=r1.2; species=Dvir;
Sequence
MFSSVGSHGISVGIASTVHDTDGYDFTKNENAARWRGLFVPSLRKVLEQVNPRVTAKEDA
LLYVENLCVRLLAKLCAQPLPHSVQDVEEKVNKSPLDRWALKEANEVINSKKRKCLLPTE
RVHTLLQKDVLQYKIDSSVSAYLVAVLECISSDILKMAADYVCNIAHSEIVKEDIEVVLN
ADGVLLDMLNRSSEQLKCNVLPSPLSLQAQRASATYEETVKELINDEKQYQRDLHMIIRV
FREELVKIARDPKELEPIFSNIMDIYEVTVTLLGSLEDVIEMSQEQNAPCVASCFEELAE
AEEFDVYKKYAHDVTSQASRDALSNLLAKPDALSLMSAGHGFREAVKYYLPKLLLVPICH
AFVYFDYIKHLMDLSTSQDDIESFAQVQGLLHPLHCDLEKVMANLSKERLVPVSGRVRRQ
MAIERTRELQLKVEHWDDKDVGLNCNEFIREDALSKLGSGKRIWSERKVFLFDGLMVLCK
ANTKKQTPSAGATAYDYRLKEKFFMRRVEINDRADTEELKHSFELITRMHPAIVLSAKNA
QHKNDWMADLIMVNTKSMLDRILDSILQDIERKHPLRMPSPEIYKFAVPDSAENIVLEER
DSGVVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCSPQQLLTLLIERFEIPEP
SLVYQEQQTNNIGGGGGNSDLDKDAATATASTADSDKMLKNSQREDWKRYRKEFVQPVQF
RVLNVLRHWVDHHFYDFEKDPTLLDRLLHFLNDVNSKSMRKWVDSVRKIVDRKNKQSNKK
IVYAYGHDPPPIEYHLNVPDDEITLLTLHPLEVARQLTLLEFEMYKNVKPSELVGSPWTK
KDKELKSPNLLKIMKHTTNVTRWIERSIMEAENYDERLAIMQRAIEVMMVMLELNNFNGI
LSIVAAMGTAAVFRLRATFNGLPERHRKFLDECRELSEDHLKKYQERLRSINPPCVPFFG
RYLTNILHLEEGNPDLLTNTELINFSKRRKVSEIIGEIQQYQNQPYCLNEEPTIRHFFEQ
LDPFNGLSDKEMSDYLYNESLRIEPRACKTVPKFPRKWPNIPLKSPGIKPRRQNQNNNSN
KLSSNAPASVEPPAAAAAASSTASTTATSIGDQSPQHNPHAYSVFAPVIIPERNGGSSWS
SHTMHRTTDNGEVAPAPHLPRKPAAHVWTHNSNAPTDGFSPAEQQLPPPATSAAATSSWN
MSDCYVISDANTAEVLPPSPLPKLMISPRHETAPPPPPPASNRSPFHGRIQQMQYSPTHS
IASTVTLISGGFGDVSPQLGGFYYNSEQGHGQTGAVPISPHVNVPTATTLEYRAVPPPLP
PRRKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPPRLNHSTATGFTRQPKEFVGKS
SSLLLPNTSSIMIRRNSAKQPSLGVSTSTATANNSAAATPMMAHSVAMAGSEEPQQQQQL
QQPPQSISPALSSSTTTSPMTPMTPMSPYIPSTVDGSTTSSFPQQQQQQHQHQTRLRPQT
AQTQQPVAYAQQHQHHHQHQHQQHHSHSHPHTHTHAHSQHQHPSQHPNRRSSPKEFFPIA
TSHEGTPKLPPKPSLSANFYNNPDKGTMFLYPSTNQE
Download sequence
Identical sequences B4M8L2
7244.FBpp0232563 XP_002057465.1.90633 FBpp0232563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]