SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232745 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232745
Domain Number 1 Region: 88-155
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000107
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 173-224
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000154
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 26-80
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000863
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232745   Gene: FBgn0205487   Transcript: FBtr0234253
Sequence length 247
Comment type=protein; loc=scaffold_12723:join(4360573..4360627,4363466..4364154); ID=FBpp0232745; name=Dvir\GJ18328-PA; parent=FBgn0205487,FBtr0234253; dbxref=FlyBase:FBpp0232745,FlyBase_Annotation_IDs:GJ18328-PA,GB_protein:EDW57866,REFSEQ:XP_002057793,FlyMine:FBpp0232745; MD5=2facaaed0292b48defd6d0d5e423919b; length=247; release=r1.2; species=Dvir;
Sequence
MAQIIISALLCLAMFGSLAQAAAGACREANGTAPVSGSCDAYIECKNGVAEEKICPDGLL
YNEKSTGYPCGYPIDVECAQGQSRLQAAQPTEDCPHQFGYYRMGDSSHCGQFMNCASGRG
FVFDCPEGLAWNPATYKCDWPDQVEDCDAEAFLGFRCPAPAVKSELLGEQEEDYTFHPSP
DNCQVYFICIEGRPRRIGCGEDQAFNQELKQCDDIDNVPNCSSDIRAKGAEIKAARAAAA
AGRRKQI
Download sequence
Identical sequences B4M9J0
FBpp0232745 7244.FBpp0232745 XP_002057793.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]