SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232746 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232746
Domain Number 1 Region: 170-220
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000837
Family Tachycitin 0.011
Further Details:      
 
Domain Number 2 Region: 80-147
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000167
Family Tachycitin 0.0097
Further Details:      
 
Domain Number 3 Region: 18-76
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000146
Family Tachycitin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232746   Gene: FBgn0205488   Transcript: FBtr0234254
Sequence length 242
Comment type=protein; loc=scaffold_12723:join(4364210..4364246,4364415..4365106); ID=FBpp0232746; name=Dvir\GJ18329-PA; parent=FBgn0205488,FBtr0234254; dbxref=FlyBase:FBpp0232746,FlyBase_Annotation_IDs:GJ18329-PA,GB_protein:EDW57867,REFSEQ:XP_002057794,FlyMine:FBpp0232746; MD5=325d7564d63b4d23e4a5c77fde074684; length=242; release=r1.2; species=Dvir;
Sequence
MQSTPNGLLEFSTLASPECPVPNGRFASGDQCDAYTECQDDVPVAKLCPDGLLFHQRTKA
TGECTYAPYSTCKERSRLQPANGTDECPRQFGFYPNGDETKCGVYRNCAHGVASLTKCPE
GLAFNEETYQCDWPDLVGSCNAEAFLGFNCPAPELVDGIAPEVDVSPEGELRYYRHPQTC
KKYFVCVNGHPRLYNCGKYLAFNAQTKLCDFYNKVPECYALLKEKQKQKAERKVPVLGQA
LE
Download sequence
Identical sequences 7244.FBpp0232746 FBpp0232746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]