SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232769 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0232769
Domain Number - Region: 135-192
Classification Level Classification E-value
Superfamily MIR domain 0.0225
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232769   Gene: FBgn0205511   Transcript: FBtr0234277
Sequence length 213
Comment type=protein; loc=scaffold_12723:4827881..4828522; ID=FBpp0232769; name=Dvir\GJ18352-PA; parent=FBgn0205511,FBtr0234277; dbxref=FlyBase:FBpp0232769,FlyBase_Annotation_IDs:GJ18352-PA,GB_protein:EDW57914,REFSEQ:XP_002057841,FlyMine:FBpp0232769; MD5=b1473b5b345a9416719c35d42d11b5df; length=213; release=r1.2; species=Dvir;
Sequence
MASAYGAVAASATVSPPPTAAGAYMPAAAAAAAAAAAQQQQQQQLLNGRPSPTASGSGSS
GGRSSAHSSGHTATAHSPALAAAAVAAAAYQLSATSAAAAAAAASSSSASATAAASSCQA
ASAFVASASMLDMQQQLEEQQQQQQQQQHHQHYLQHQQHLQLQHQQQQQQLQHHQHQQQQ
QQQQHQLYHYHATHSQQLHAHEASAGLLDISTL
Download sequence
Identical sequences FBpp0232769 7244.FBpp0232769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]