SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233144 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233144
Domain Number 1 Region: 220-273
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000115
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233144   Gene: FBgn0205880   Transcript: FBtr0234652
Sequence length 280
Comment type=protein; loc=scaffold_12970:complement(8800707..8801263,8801330..8801593,8802089..8802110); ID=FBpp0233144; name=Dvir\GJ18727-PA; parent=FBgn0205880,FBtr0234652; dbxref=FlyBase:FBpp0233144,FlyBase_Annotation_IDs:GJ18727-PA,GB_protein:EDW65748,REFSEQ:XP_002055547,FlyMine:FBpp0233144; MD5=8d49684b182cecc4d35a9de8a341d723; length=280; release=r1.2; species=Dvir;
Sequence
MKHFEVKATDAPRTQNPLFKRRLTLTSTATPPRISTTALSIDTTTYLPGIEDDNDQVARS
SIHTSRFNHISEHLRPGLSFELPNSISSVGVANITRRQMIPRPRRPQSATPTPSTTAATV
TAASSPPASRRQQSRRRPHKYIEVYSRPPSKPEVATATSTANRRSGVVDHEIYDQNRASV
TKQSRRRNEPARLHVQGQSQSQPKSQTLPKVIVHGQGIIECLDQGNFPHPLNCRKFISCA
KFDGTGGIVGWEYTCPKGLGYDGDSGMCTWAAAGERACHN
Download sequence
Identical sequences FBpp0233144 7244.FBpp0233144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]