SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233403 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233403
Domain Number 1 Region: 10-106,135-161
Classification Level Classification E-value
Superfamily SH2 domain 1.41e-25
Family SH2 domain 0.0001
Further Details:      
 
Domain Number 2 Region: 220-282
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000263
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233403   Gene: FBgn0206132   Transcript: FBtr0234911
Sequence length 298
Comment type=protein; loc=scaffold_13052:complement(1422594..1422842,1422901..1423059,1423610..1423738,1423808..1424012,1424078..1424200,1424354..1424385); ID=FBpp0233403; name=Dvir\GJ18986-PA; parent=FBgn0206132,FBtr0234911; dbxref=FlyBase:FBpp0233403,FlyBase_Annotation_IDs:GJ18986-PA,GB_protein:EDW71132,REFSEQ:XP_002059734,FlyMine:FBpp0233403; MD5=4b729423d6b818582b14c5afb3bd7d0f; length=298; release=r1.2; species=Dvir;
Sequence
MDTFDVSDRSSWYFGSMSRQDATEVLMNERERGVFLVRDSNSIEGDYVLCVREDTKVSNY
IINKVQQQDQIVYRIGDQSFENLPKLLTFYTLHYLDTTPLKRPAQKKLEKVIGKFDFVGS
DQDDLPFQRGEVLTIIRKDEDQWWTARNSTGLVGQIPVPYVQRYDDSMEEDGIEHLANLN
SSSCIARSTISSAISNVDSPSVSSSQFSTLKRTDLNRKLPARARVKQSRVPNAYDKTALK
LEVGDIIKVTKTNINGQWEGELNGRKGHFPFTHVEFVDDCDVNNCADIRLNNDWAEQQ
Download sequence
Identical sequences B4MF31
XP_002059734.1.90633 7244.FBpp0233403 FBpp0233403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]