SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233433 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0233433
Domain Number - Region: 96-132
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00199
Family Tachycitin 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233433   Gene: FBgn0206162   Transcript: FBtr0234941
Sequence length 141
Comment type=protein; loc=scaffold_12823:join(2472928..2473215,2473275..2473412); ID=FBpp0233433; name=Dvir\GJ19016-PA; parent=FBgn0206162,FBtr0234941; dbxref=FlyBase:FBpp0233433,FlyBase_Annotation_IDs:GJ19016-PA,GB_protein:EDW58895,REFSEQ:XP_002059483,FlyMine:FBpp0233433; MD5=4e8f60a313cfc5246dee13fe566f7d67; length=141; release=r1.2; species=Dvir;
Sequence
MTNCIWLLALVVAINARSLHVPHGYGGGLPPPPPPPPHLLPNPYYAQPYGYPPAPAYGYG
YQPQPLLYSPPGSYYDSMYGIRKPLPGGGNPVAVDYNNRCSRNYVGIKPHPDQQQYYYVC
RPNCVIFSKCPNLEVSYSQPA
Download sequence
Identical sequences 7244.FBpp0233433 FBpp0233433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]