SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233471 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233471
Domain Number 1 Region: 310-493
Classification Level Classification E-value
Superfamily MIR domain 9.68e-57
Family MIR domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233471   Gene: FBgn0206199   Transcript: FBtr0234979
Sequence length 747
Comment type=protein; loc=scaffold_12970:complement(1242206..1242399,1243763..1244165,1244286..1244434,1244503..1244743,1244817..1245023,1245084..1245658,1245721..1245829,1245888..1245992,1246416..1246500,1246560..1246643,1246723..1246814); ID=FBpp0233471; name=Dvir\GJ19054-PA; parent=FBgn0206199,FBtr0234979; dbxref=FlyBase:FBpp0233471,FlyBase_Annotation_IDs:GJ19054-PA,GB_protein:EDW65159,REFSEQ:XP_002054958,FlyMine:FBpp0233471; MD5=96529b4e49e37f76f237928ab7614c70; length=747; release=r1.2; species=Dvir;
Sequence
MAASVVKAPKCTRKPKDLPKTEPARLNDDNWRWWAFMGAVLLITFATRFYKVTEPDHICW
DETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNETRYQGM
RYFCTTLGALIMPMGFDTVYDLTRSHEAALLSAAYLIFDVGMLTLNQYILLDPILLFFMM
GSVWGMVKISKCTAAGGSYTARWWLWLLLTGTMLSCTISVKFVGLFVVLLVGLHTASELW
MILGDLRKPIVETGKQIACRAVALIIWPILLYTFFFYIHLSVLNRSGNGDGFYSSAFQSR
LIGNSLYNASMPRDVAYGSLVTIKNHKTGGGYLHSHAHLYPKGSGARQQQITTYTHKDDN
NIWLIKPYNKPALPKDELRLLQHGDLLRLEHLVTKRNLHSHSEPAPMTKKHLQVTGYGEL
GVGDANDVWRVLIVGGKPNETIHTVTSRLMFVHYLQNCALTSSGKQLPKWGFEQQEVSCN
LNVRDKNAQWNVEDNQHKLLPSVSFSIYAPGFFARFLESHAVMLQGNAGLKPKEGEITSQ
PWQWPINYRGQFFSGTSYRIYLLGNPIIWWSNLIFLLLFVVVFLYNAVLEQRRAGQAALH
ATGQPEELAATTELCSCCPAGSDQQKSAEDTTTTGLSDSAMSLRAAAWLFIGWLLHYLPF
WAMGRVLYFHHYFPALIFNSLLTGIMFNYIIRSLPRWLQHVLLGTLLSVLVYSFVLFSPL
AYGMSGPLANEPNSTMHNLKWLATWEF
Download sequence
Identical sequences FBpp0233471 7244.FBpp0233471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]