SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233534 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233534
Domain Number 1 Region: 125-187
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000419
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233534   Gene: FBgn0206262   Transcript: FBtr0235042
Sequence length 188
Comment type=protein; loc=scaffold_12970:1510436..1511002; ID=FBpp0233534; name=Dvir\GJ19117-PA; parent=FBgn0206262,FBtr0235042; dbxref=FlyBase:FBpp0233534,FlyBase_Annotation_IDs:GJ19117-PA,GB_protein:EDW65177,REFSEQ:XP_002054976,FlyMine:FBpp0233534; MD5=09a6588293822500769b9db93f9d7105; length=188; release=r1.2; species=Dvir;
Sequence
MEECRTPTGQHLFSYNRTPILSVINKNAQNIRCSTPIFGDLRSPNMSPIRDMRAPRRTTS
STFFKKAFKKQQLSKPSLKPPGRKLEDRNNSLDEFMDDSGSGNSAENSLCKESRRRSLLA
ANHSYVINHASNVHDVLLLVGLESYLDKFEKAHVDLVELVSMEHKDLKRLGLRNDEDCNR
ILDALKEI
Download sequence
Identical sequences B4M302
XP_002054976.1.90633 7244.FBpp0233534 FBpp0233534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]