SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233864 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233864
Domain Number 1 Region: 268-327
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000154
Family Tachycitin 0.028
Further Details:      
 
Weak hits

Sequence:  FBpp0233864
Domain Number - Region: 22-75
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000149
Family Tachycitin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233864   Gene: FBgn0206590   Transcript: FBtr0235372
Sequence length 330
Comment type=protein; loc=scaffold_12970:join(9361385..9361693,9361892..9362575); ID=FBpp0233864; name=Dvir\GJ19447-PA; parent=FBgn0206590,FBtr0235372; dbxref=FlyBase:FBpp0233864,FlyBase_Annotation_IDs:GJ19447-PA,GB_protein:EDW65800,REFSEQ:XP_002055599,FlyMine:FBpp0233864; MD5=1619be020afec7b3b303f76d27463d9b; length=330; release=r1.2; species=Dvir;
Sequence
MLNIHLALAAMCLVLCGAAQAGDSHPCSRTGFVALVDNAQEYFACEPTPNGGYSLRRLRC
QDNMSFNSVLAKCVERSRDAVAADGSDIENPTIPPGNFEDSTDEPEPTDAPGSTKEPEPT
DAPGSTKEPEPTDAPGSTKEPEPTDAPGSTKEPEPTDAPGSTKEPEPTDAPGSTKEPEPT
DAPGSTKEPEPTDAPGSTKEPEPTDAPGSTKEPEPTDAPGSTKEPEPTDAPGSTKEPEPT
DAPGSTKEPEPTDASTTEQPGTSTTVKEVCATTGFLPKNGNCYQYVICYEDDEGDLIALT
QDCPEGMQFNPDSRYCELGYDCNNPTTPEQ
Download sequence
Identical sequences FBpp0233864 7244.FBpp0233864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]