SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233915 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233915
Domain Number 1 Region: 407-505
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000403
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 145-230
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000877
Family N-terminal PAS domain of Pas kinase 0.078
Further Details:      
 
Domain Number 3 Region: 40-93
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233915   Gene: FBgn0206641   Transcript: FBtr0235423
Sequence length 843
Comment type=protein; loc=scaffold_12970:join(10362232..10363524,10364572..10365810); ID=FBpp0233915; name=Dvir\GJ19498-PA; parent=FBgn0206641,FBtr0235423; dbxref=FlyBase:FBpp0233915,FlyBase_Annotation_IDs:GJ19498-PA,GB_protein:EDW65883,REFSEQ:XP_002055682,FlyMine:FBpp0233915; MD5=4796c73e01742fcc07dbd4bf4625d65d; length=843; release=r1.2; species=Dvir;
Sequence
MAAVVAATANGSGGGSGSGCVAVMTVSVADSETSDASGASNGREARNLAEKQRRDKLNAS
IQELATMVPHAAESTRRLDKTAVLRFATHGLRLQYVFGKSATRRRRRLNVKGAGRGGDSS
GSGGNGNGVIAGDTPLLTDTLMQLLDSFFLTLTCNGQIVLVSGSVEQLLGHCQSDLYGQN
LLQITHPDDQALLRQQLIPRDIETLFYQQRRKQHSQSHSQSQSTSASDDDDNDDGDDELE
QDLERTRTPSPQTIAHMAAIDERLRADRRCFTVRLARASTRAEATRHYEVVKIDGCFRRS
DSSVTGGAAANYPIVSQLIRRSRNNNMLAAAAAAAAAGTVPASTTSAATLTPPCLPQHDA
IAQAALHGISGNDIVLVAMARVMREESNCLSLLCRQPEPYQLEYRTRHLIDGSIIDCDQR
IGIVAGYMKDEVRNLSPFSFMHLDDVRWVIVALRQMYDCNSDYGESCYRLLSRNGHFIYL
QSKGFLEVDKSSNKVHSFLCVNTLLDEQAGKRKVQEMKNKFSTIIKADIPTHTSPDLPAS
RAPQQLERIVLYLIENLQKSANSAGVNGSADSSNGDVNMDTMEDICCSSPASSNTTLTLD
EQAPSPAQLALVPPAPGHVKNSISKSVNVVNVTSARNLQYQQQQQQQKLQQEQRERGEAN
GGVIRQLSYSLSESSTLSPASASSLELPDDANSNASPPPAATPRVSVLQRLMTTTPSPTS
TPKVPEAAAAEATSPSPLPSPTTQLQAALSNSLRSLDTKLSKMGEEAQTLYKQQQEQHSA
FLPEFERQMDAIMLEHQMQKQLLVNIKSEYKAAAATNEVPAAHQPVSVITKQTTTSSESS
GDK
Download sequence
Identical sequences B4M2H9
XP_002055682.1.90633 XP_015026715.1.90633 7244.FBpp0233915 FBpp0233915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]