SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0234307 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0234307
Domain Number 1 Region: 27-300,392-440
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.26e-62
Family Type II chitinase 0.000000163
Further Details:      
 
Domain Number 2 Region: 301-392
Classification Level Classification E-value
Superfamily Chitinase insertion domain 6.62e-28
Family Chitinase insertion domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0234307   Gene: FBgn0207032   Transcript: FBtr0235815
Sequence length 442
Comment type=protein; loc=scaffold_12875:complement(19987274..19987920,19987979..19988539,19988676..19988796); ID=FBpp0234307; name=Dvir\GJ19890-PA; parent=FBgn0207032,FBtr0235815; dbxref=FlyBase:FBpp0234307,FlyBase_Annotation_IDs:GJ19890-PA,GB_protein:EDW62184,REFSEQ:XP_002050991,FlyMine:FBpp0234307; MD5=65f99da73aaad750c1e33296bf41d9d1; length=442; release=r1.2; species=Dvir;
Sequence
MLPHGWIFLGALLCLCRCPVSLADVAKLVCYYDASSFVREGPAQLSLNELEPALNFCNYL
IYGYAGIDPESFKIKSLNPELSYNRQHYAHITALRQKHPHLRILLSVGGERDLNAEGLPD
SSKYLSLLELPENRNSFKASASAELNKYGFDGLDLAWQFPQLKPKQQQGALKRAWSSFKG
WFSSSSIDPKAEEHKEQFATFVRELRVELQRNGKQLTLSMLPHVDPELFIDIPAVLAFVD
FVNLGTYDFQTPQRDPKQADLPAPLYAMYDRDATHNVQHQLQYWLNHTANAQQLNIGITS
YGRAWQMSPNSGITGFPPITATEGAAPAGKQTGQPGLLSWPEICDLLQHHLGQGKDTDNQ
HLRKVGDPTKRYGIYAYRAAGENGENGLWVGYEDPTTAAIKAGFVQAQGLGGVAFHDLSL
DDFRGQCAGEKYPILRSIKYKL
Download sequence
Identical sequences B4LNK4
XP_002050991.1.90633 7244.FBpp0234307 FBpp0234307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]