SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0234328 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0234328
Domain Number 1 Region: 23-187,256-303
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.77e-53
Family Type II chitinase 0.00021
Further Details:      
 
Domain Number 2 Region: 187-255
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000000305
Family Chitinase insertion domain 0.0013
Further Details:      
 
Domain Number 3 Region: 320-373
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000018
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0234328   Gene: FBgn0207053   Transcript: FBtr0235836
Sequence length 396
Comment type=protein; loc=scaffold_12875:complement(19787629..19788526,19788579..19788801,19789112..19789181); ID=FBpp0234328; name=Dvir\GJ19911-PA; parent=FBgn0207053,FBtr0235836; dbxref=FlyBase:FBpp0234328,FlyBase_Annotation_IDs:GJ19911-PA,GB_protein:EDW62153,REFSEQ:XP_002050960,FlyMine:FBpp0234328; MD5=f246c1ef87bbd533bdcb156d60ebc901; length=396; release=r1.2; species=Dvir;
Sequence
MKVSFVVFLIVDSLLSTFASDTKWRHNYKLLISVGGMKDDAKMFSKMAASMAKRDQFYKS
LLKFLSQWKCSGVLLDWEYPSPEDRDNFVKLLKELKIVLQDRNFVLLVSVSARMDDATLR
SYDIPRIARHADFIILNIHDNEDPYGPKVEYNSPLYGNGSRSVERGVRYWVEQSKISEKL
ILGIPLFGRTFTLEDASKTAVGAPSKGPGRQHVHSSRAGFMTFGEFCIQTARWEIKYDKQ
AQVPYAYMDDQWITFENGRSISAKMHLAMKQELGGAMVWSIDADDFHGTCGETYGLLKVV
VSFMGSPNILTTRAPITDGFCPKDGLFRNKWNCQAYYECRNGRRTDYECSEVEFFDEKLG
QCKPSEEVKCNQDFVDWSPGENGYSSENLPLNLRVV
Download sequence
Identical sequences FBpp0234328 7244.FBpp0234328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]