SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0234411 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0234411
Domain Number 1 Region: 612-952
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.18e-105
Family PDEase 0.00000144
Further Details:      
 
Domain Number 2 Region: 374-463
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000227
Family Heme-binding PAS domain 0.058
Further Details:      
 
Weak hits

Sequence:  FBpp0234411
Domain Number - Region: 102-162
Classification Level Classification E-value
Superfamily CbiD-like 0.0314
Family CbiD-like 0.0085
Further Details:      
 
Domain Number - Region: 229-334
Classification Level Classification E-value
Superfamily CheY-like 0.0522
Family CheY-related 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0234411   Gene: FBgn0207135   Transcript: FBtr0235919
Sequence length 956
Comment type=protein; loc=scaffold_12875:complement(18427990..18428135,18428197..18428464,18428526..18428686,18428745..18428964,18429024..18429272,18429736..18429834,18429892..18430032,18431381..18431591,18431677..18431846,18431932..18432042,18432238..18432336,18432468..18432522,18432579..18432638,18432764..18432969,18433073..18433129,18436753..18436874,18437279..18437383,18444602..18444692,18444807..18445106); ID=FBpp0234411; name=Dvir\GJ19994-PA; parent=FBgn0207135,FBtr0235919; dbxref=FlyBase:FBpp0234411,FlyBase_Annotation_IDs:GJ19994-PA,GB_protein:EDW62001,REFSEQ:XP_002050808,FlyMine:FBpp0234411; MD5=ff9c43f7bc122d9d41bb2900bef62a94; length=956; release=r1.2; species=Dvir;
Sequence
MGCSPSTLPNSSSSAAAAPGGGGNGGNANLPLDGNEKDGSLLFCIKLRRSRMRRCSCGAV
TLQNQNGEGSTGSATCGDNMMCNQGLLNPLQTKNESDYEKLSTGKKDSIVTVAALGNFTH
SVVRRATGTGTAAAAAAAAATTTTRTTMTSRASLTRPASESELLVGTGTSGTSSSGGGGG
SGRPGHRKSSLALALTPEDESMDVYQRNLMDLKYPTVLPPNPQLKALLVFHKSDSICEVV
TLACQRHQLDATLVKSKEEALETLHKSYATAQCYHLIIIDARSTKGLDAEHIARTIRHTH
GHHLTTIIAVCKKSFFEKDDALIALLDAGVNRCIAETTNLAMCSVELKQILHSIIRPHNV
MSTQQALYTALHRLKEVVLITDDVLRIQYANRATERLLNMRLDEIISKPLADIFVSDLST
ISEQGKSIKEFDGILTVRRKNQEGIPMHVRVVPVACIGSAPTHLIFNFDIPGGGMDFIAT
LPQPKEAPRGSLHSVRRCSFDVRSIASDGLRRTSLAKLTSLPLEAPITKENCSADEARLI
DKVLEFLKREGLYSPQMKEIRTDDPIATDLIGALLTGPSVYSSRRSSNDSIIRTGNSTRA
ATIVPAKMKANPIIMELLEESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNID
ENVCKAWLAVIEAHYHKSNTYHNSTHAADVMQATGAFITQLANKDMVMDRMDEATALIAA
AAHDVDHPGRSSAFLCNSNNPLAILYNDLTVLESHHAAITFKLTLGDDKINIFKNLDKET
YKSARSTIIDMILATEMTRHFEHLAKFVSVFGSEVEPRELVQSEEETSILMRRMLIKVAD
VSNPARPMQYCIEWARRIAEEYFMQTDEEKQRHMPIVMPMFDRATCSIPKSQIGFIEYII
QDMMHAWDGFLDMPQLITCMQINYSQWKKYDEQGVNTLADIMAKQPPVGNKTSNSK
Download sequence
Identical sequences 7244.FBpp0234411 FBpp0234411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]