SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0234598 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0234598
Domain Number 1 Region: 307-496,603-857
Classification Level Classification E-value
Superfamily Ras GEF 5.23e-100
Family Ras GEF 0.00019
Further Details:      
 
Domain Number 2 Region: 508-612
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-31
Family Ras-binding domain, RBD 0.0014
Further Details:      
 
Domain Number 3 Region: 50-188
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.83e-30
Family DEP domain 0.0000933
Further Details:      
 
Domain Number 4 Region: 161-310
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-26
Family cAMP-binding domain 0.00000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0234598   Gene: FBgn0207321   Transcript: FBtr0236106
Sequence length 861
Comment type=protein; loc=scaffold_12875:complement(15564532..15564662,15565096..15565445,15565514..15565647,15566339..15566509,15566578..15566831,15566893..15567254,15568956..15569117,15569313..15569489,15571249..15571393,15572067..15572212,15572531..15572723,15572838..15572979,15573045..15573131,15574004..15574098,15574669..15574705); ID=FBpp0234598; name=Dvir\GJ20181-PA; parent=FBgn0207321,FBtr0236106; dbxref=FlyBase:FBpp0234598,FlyBase_Annotation_IDs:GJ20181-PA,GB_protein:EDW61674,REFSEQ:XP_002050481,FlyMine:FBpp0234598; MD5=9350dc28d727e2602e6f31c71dd3b64c; length=861; release=r1.2; species=Dvir;
Sequence
MNDIITNCKLKNGFGPGVQPAAATSPTKRPLSPDHPNPALPITETPSPAMNRMGWALRTL
LVVDNSSCLKDRKVSGKLIRKCAPGTELVDWLVNLAPIVHTRAQAAGMWQALLEEGVLTH
VNKEQPFKDKCFLYRFRLDEEGGAPAAGIPAAEDLSAANEHIREALSALFQRGPDATLRM
ILRKPSHERTPEELELVFEELVHIAALSHLSTSIKRELSSIIVFEAHAQAGTILFNQGDE
GRSWYILLKGSVDVVIHGKGTVATLKTGDDFGKLALINDAPRAATIVLKENNCHLLRVDK
EHFNRILRDVEANTLRLQEHGKDVLVLERVAKQRGQHSAFKYTVMSGTPNKMLEHLLETR
LGQTVSGMDPFLDDFLLTHIVFMPVVQLVDELANYFHCDAHEEAQTPEDREYIINFKKRV
IQFMQKWVMAVRHAAFEEPSVCDFIEDLAAEVEADPDLNEETSIIHNVLTQMARYQEDRN
QNAGQKWKLPTNGQPICLFSGNATPSKTVIRPDDDIIFRVYCADHTYCTLRFPMHTTAEL
IKACAADKLQLNRGPDDLCLVEVKSNGERSVFKDNDVSIPTGLTLNGRLFVSVKDHLDAL
TPLPEQECPTEGVDIDLEILSTKELAYHITIFEWDLFWAVHEYELLYHTFGRHHFGKITA
NLDVFLRRFNEVQYWIVTELVSTPSLSKRVGLVRKFIKLAAYCKEYQNLNAFFAIVMGLS
NMAVTRMHQTWEKIPSKFRKIFQEFEALIDPSRNHRAYRVFVGKLQPPLIPFMPLLLKDM
TFAHEGNKTSLDGLVNFEKMHMMAQTMRTIRFCRSRSLGLEPPSPKSEGEVRAYISSFRV
IDNQRVVTAMSQKVEPTRKLN
Download sequence
Identical sequences 7244.FBpp0234598 FBpp0234598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]