SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0234956 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0234956
Domain Number 1 Region: 8-64
Classification Level Classification E-value
Superfamily EF-hand 0.0000000338
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0234956   Gene: FBgn0207679   Transcript: FBtr0236464
Sequence length 113
Comment type=protein; loc=scaffold_12875:complement(10930217..10930312,10930363..10930573,10930639..10930673); ID=FBpp0234956; name=Dvir\GJ20539-PA; parent=FBgn0207679,FBtr0236464; dbxref=FlyBase:FBpp0234956,FlyBase_Annotation_IDs:GJ20539-PA,GB_protein:EDW61006,REFSEQ:XP_002049813,FlyMine:FBpp0234956; MD5=c7faa428371cc7c290f62cf33fc3d515; length=113; release=r1.2; species=Dvir;
Sequence
MAHLSPLLMDRKMEPASAEQILAAFEVLDPENKRFLTKEYFGKLMKEEGEQFNDDEMKAM
WRVAIDPITENVPYVFYINQLKHKTTIYDVAEVLKEELASNDKEKKKERNPMP
Download sequence
Identical sequences FBpp0234956 7244.FBpp0234956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]