SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0235412 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0235412
Domain Number - Region: 219-260
Classification Level Classification E-value
Superfamily MIR domain 0.0942
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0235412   Gene: FBgn0208130   Transcript: FBtr0236920
Sequence length 302
Comment type=protein; loc=scaffold_12875:complement(2779039..2779230,2779298..2779402,2779462..2779977,2780037..2780132); ID=FBpp0235412; name=Dvir\GJ20995-PA; parent=FBgn0208130,FBtr0236920; dbxref=FlyBase:FBpp0235412,FlyBase_Annotation_IDs:GJ20995-PA,GB_protein:EDW60206,REFSEQ:XP_002049013,FlyMine:FBpp0235412; MD5=53af67b8a5f2ed8f966ad389835ff5b8; length=302; release=r1.2; species=Dvir;
Sequence
MPCTVSNFESGSNRYRPNVRIGNWFEDICLEEDKIVSFRKMRDRGELLVEKARTLFDNFQ
KEVQLAAPKHDITIGATIQLMPIYMNILDMDTSELHPALSVVINEHAIRTSQTINEDCEL
TVAPSERPCVRNSYRIVSGDDHDRTGEKLKYGQRFRLECVESPDDPILLYSAPKLNNLSQ
AINTTFNSAKYGEINLPLGLVHRSKIMCRDGDIPSAFTNWFCMHVDPHKRFESEGETLPS
NSPLVIVHAATNRNLAAENVVTQTLFGPEFLVSVQNYRNVYKREIWKNVWMISNGHHTHA
AH
Download sequence
Identical sequences B4LP97
XP_002049013.1.90633 7244.FBpp0235412 FBpp0235412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]