SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0235986 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0235986
Domain Number 1 Region: 661-934
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-73
Family Protein kinases, catalytic subunit 0.00000198
Further Details:      
 
Domain Number 2 Region: 117-278
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.27e-33
Family Ankyrin repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 9-109
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-26
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 4 Region: 270-409
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-20
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0235986   Gene: FBgn0208689   Transcript: FBtr0237494
Sequence length 947
Comment type=protein; loc=scaffold_12875:join(6949065..6949149,6949234..6949310,6949653..6950069,6950129..6950662,6950722..6951958,6952023..6952516); ID=FBpp0235986; name=Dvir\GJ21569-PA; parent=FBgn0208689,FBtr0237494; dbxref=FlyBase:FBpp0235986,FlyBase_Annotation_IDs:GJ21569-PA,GB_protein:EDW60608,REFSEQ:XP_002049415,FlyMine:FBpp0235986; MD5=398b20e07e6a40d1de75e9c453337660; length=947; release=r1.2; species=Dvir;
Sequence
MAAYPRDDQMKWYHGRLTREAADDLLKQGYEDGTFLVRESSTAAGDFVLSLFHQGEVCHY
QIRRHGEDAFFSIDDKGQTKILHGLETLVKYYQQEPNGLVTKLSSPLPGDPPPHNTRSQG
VTNLLHRATSKNESKVVFELLKCGNRNFDAKNKDGQTALHLAALNCNEDILKLLLDARVQ
VNSSDSFGYQPLHYACRQKPASFIRTLIAAQANVQGRNIENGHVPLHEAAKHGNLEAVQE
LLAAQAPLLPRTSSGEFPFDLAKEAGQTAVEQFLLDYKLPPASTSREHWYHGTLKRDEAV
AILQQFAHQLQRKQQATGQPVDTSGCFLVRYSESPAAAGYVLTLLSGQVAKNFLISQADL
YQNGNKLPSSGSKFLYIDDGPYWPSLEHLVAHFMRFSYGLPVSLKYPVPPLPKPELPSFA
TIPRATQKQRDNHSAPGTPLSPHPSGSAYQAHVPALTITKKKQKENSSSMFNTLRIVSPK
KSLFDMNSLRKSKSKSKRSDSESSVSIMAAARANEELQAAAPIMKNLSFSTDFSNFNVDT
GEVYNVPRNNTPIEMPPIANKTEDEVEYFTKSDVAIERERAAALTANGYLPTMDVHMLLD
QPLQQLDGSGKQMSRLDSVISTGSTESEMAGYLQRKCSGGVGGGGANELNSAELEAAKQR
FLIHHEHLELDSEIGAGEFGSVYRGWLRMPGVQPVQRLEVAIKTLRDEKQQTLNKQEFLR
EASVMMRLEHKCIVRLIGISKGDMLMMVQELAPLGSMLQYILDHSDEMKVNYELKLWASQ
IACGMHYLETQHFVHRDLAARNILLTSRQQAKISDFGMSRSLSAGSDEYHFTQGGRWPIR
WYAPESFNNGIFSHASDVWSFGVTLWEMFALGAPPYGDISNVDAIKLVDSGQRLPQPNMC
PAYIYAVMQSCWNYHPRERPTFAYLMEFFSRDPEYQNLPELVQSVHI
Download sequence
Identical sequences B4LK19
XP_002049415.1.90633 FBpp0235986 7244.FBpp0235986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]